KEGG   Mus musculus (mouse): 66310
Entry
66310             CDS       T01002                                 

Symbol
Dpy30, 2810410M20Rik, C87842
Name
(RefSeq) dpy-30, histone methyltransferase complex regulatory subunit
  KO
K14965  protein dpy-30
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66310 (Dpy30)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     66310 (Dpy30)
    MLL-HCF complex
     66310 (Dpy30)
    MLL3/MLL4 complex
     66310 (Dpy30)
SSDB
Motif
Pfam: Dpy-30 RIIa
Other DBs
NCBI-GeneID: 66310
NCBI-ProteinID: NP_001139694
MGI: 1913560
Ensembl: ENSMUSG00000024067
UniProt: Q99LT0
Position
17; 17 E2
AA seq 99 aa
MESEQMLEGQTQVAENPHSEYGLTDSVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN
NT seq 300 nt   +upstreamnt  +downstreamnt
atggagtcggagcagatgctggagggacagacacaggttgcagaaaaccctcactctgag
tacgggctcacagacagcgttgagagaatagtcgaaaatgagaagattaatgcagaaaag
tcatcgaaacagaaggtggatctacagtccttgcccacccgtgcctacctggaccagaca
gttgtgcctatcttattacagggacttgctgtgcttgccaaggaaagaccaccaaatccc
atcgagttcctagcatcttatcttttaaaaaacaaggcgcagtttgaagatcgaaattga

DBGET integrated database retrieval system