KEGG   Mus musculus (mouse): 66311
Entry
66311             CDS       T01002                                 

Gene name
Cenpw, 2610036L11Rik, Cug2
Definition
(RefSeq) centromere protein W
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CENP-W CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 66311
NCBI-ProteinID: NP_001103217
MGI: 1913561
Ensembl: ENSMUSG00000075266
Vega: OTTMUSG00000063723
UniProt: Q3URR0 B2RVH1
Position
10; 10 A4
AA seq 86 aa
MAPSTTVTRRVKRKAPRAFLKRTLKQKKPHLGLGRCCDLLIHLNCLLFIQRLAEESRTNA
CESKSRVIKKDHVLAAGKVILKKSRG
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcgccctccaccacagtcactaggcgggtaaagcgcaaggcgccccgcgccttcctc
aagcgcaccttaaagcagaagaagcctcacctaggtctggggaggtgctgcgacctcctg
atccatttgaattgcctactttttattcagcgattggcagaagagtccaggacaaatgct
tgtgaaagtaaatctagagttatcaaaaaggatcatgtactggctgcaggaaaggtaatt
ctgaagaagagcagaggttag

DBGET integrated database retrieval system