KEGG   Mus musculus (house mouse): 66314
Entry
66314             CDS       T01002                                 
Symbol
Tpd52l2, 2810411G23Rik, AU016537, C86069, D54
Name
(RefSeq) tumor protein D52-like 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TPD52 VASP_tetra
Other DBs
NCBI-GeneID: 66314
NCBI-ProteinID: NP_079758
MGI: 1913564
Ensembl: ENSMUSG00000000827
UniProt: Q9CYZ2 Q3TUJ9
Position
2:181138935..181159755
AA seq 220 aa
MDSASQDINLNSPNKGVLSDFMTDVPVDPGVVHRTPVVEGLTEGEEEELRAELAKVEEEI
VTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSTAYVKTSEKLGEWNEKV
TQSDLYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMSSYSIRHSISMPVMRNSATFKS
FEDRVGTIKSKVVGGRENGSDNLPPSPGSGDQTLPDHAPF
NT seq 663 nt   +upstreamnt  +downstreamnt
atggactctgctagccaagatatcaacctgaattctcctaacaaaggtgtgctgtctgac
tttatgactgacgtccctgttgacccaggtgtggtccaccggactccagttgtagaaggc
ctgacagagggggaggaagaagagcttcgggctgagcttgctaaggtggaagaagaaatt
gtcactctgcgccaggtgctggcagccaaagagaggcactgtggagagctgaaaaggagg
ctgggcctctccacattaggggagctgaagcagaacctgtctaggagctggcatgatgtg
caggtctctactgcctatgtgaaaacgtctgagaaacttggagagtggaatgagaaagtg
acgcagtctgacctctacaagaagactcaagaaactctttcacaggctggacagaaaaca
tcagctgccctgtccaccatgggctctgccatcagcaggaagcttggagacatgagcagc
tactccatccgccactcgataagtatgcctgtcatgaggaactcagccaccttcaagtca
tttgaagaccgagtggggaccataaagtctaaggttgtgggtggcagagagaatggcagc
gataacctccctccctctcctggaagtggtgaccagacattgccggatcatgcgcctttc
taa

DBGET integrated database retrieval system