KEGG   Mus musculus (mouse): 66317Help
Entry
66317             CDS       T01002                                 

Gene name
Wdr61, 2700038L12Rik, 2810418I05Rik, REC14
Definition
(RefSeq) WD repeat domain 61
  KO
K12602  WD repeat-containing protein 61
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    66317 (Wdr61)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    66317 (Wdr61)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     66317 (Wdr61)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Cytochrom_D1 Nup160 HPS3_N GSDH Frtz WD40_like Nucleoporin_N DUF2415
Motif
Other DBs
NCBI-GeneID: 66317
NCBI-ProteinID: NP_001020546
MGI: 1917493
Ensembl: ENSMUSG00000061559
Vega: OTTMUSG00000027395
UniProt: Q9ERF3 A0MNP4
Position
9; 9 A5.3
AA seq 305 aa AA seqDB search
MTNQYSILFKQEQAHDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKWRDERLELQWSL
EGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPVDAWTLAFSPDSQY
LATGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATG
KLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAF
CPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHV
YDCPI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccagtacagtattctcttcaagcaagagcaagcccatgatgatgccatatgg
tcagttgcctgggagacaaacaaaaaggaaaacattgaaacagtggtcacaggatccctg
gatgacctggtgaaggtctggaaatggcgtgatgagaggctggagctccagtggagcctg
gagggacatcagctcggggtggtgtctgtggacatcagccacactcttcccattgctgca
tccagctctctagacgctcatattcgcctctgggacttggaaaatggcaaacagatgaag
tctatagatgcaggaccagtggatgcctggactttggcattttctcctgactcccagtat
ctggccacaggaactcacatggggaaagtgaacatttttggtgtggaaagtggaaaaaaa
gaatattctttggacactagaggaaaattcatccttagtattgcatatagtcctgatggg
aaatacctggccagcggagccatagacggaatcatcaatatttttgacattgcaactgga
aagcttttgcatacgctggaaggccatgcgatgcccattcgctccttgaccttttcccct
gactcccagctccttgtcacggcttcagatgatggctacatcaagatctatgatgtacaa
catgccaatttggctggcacactgagtggccatgcgtcctgggtgttgaatgttgcgttc
tgtcctgatgacactcactttgtctccagttcatctgacaaaagtgtgaaggtttgggat
gttggaacaaggacctgtattcacaccttctttgatcaccaggatcaggtttggggagta
aaatataatggaaatggatcaaaaattgtatctgttggagatgaccaggaaattcatgtc
tatgactgcccaatttaa

DBGET integrated database retrieval system