KEGG   Mus musculus (house mouse): 66335
Entry
66335             CDS       T01002                                 
Symbol
Atp6v1c1, 1700025B18Rik
Name
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit C1
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66335 (Atp6v1c1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    66335 (Atp6v1c1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66335 (Atp6v1c1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    66335 (Atp6v1c1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    66335 (Atp6v1c1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    66335 (Atp6v1c1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    66335 (Atp6v1c1)
SSDB
Motif
Pfam: V-ATPase_C DUF4300 NRIP1_repr_1 Folliculin
Other DBs
NCBI-GeneID: 66335
NCBI-ProteinID: NP_079770
MGI: 1913585
Ensembl: ENSMUSG00000022295
UniProt: Q9Z1G3
Position
15:38662096..38692688
AA seq 382 aa
MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKAL
RVFVESVLRYGLPVNFQAMLLQPNKKSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgactgagttctggctcatatctgctcctggggagaaaacctgtcagcaaacatgggag
aaactacatgcagcgaccaccaagaacaataatcttgccgtctcttccaagttcaacatt
cctgacctaaaggttggcacgttggatgtcttggttggcttgtcggatgaactggctaaa
ctggatgcatttgtagaaggtgtggtcaagaaagtggctcagtacatggctgatgtgctg
gaggacagcaaagataaagttcaggagaacttgctggccagcggagttgacttggttact
tacataacaaggttccagtgggatatggctaaatatccaatcaagcagtctctgaaaaat
atttctgaaataattgccaagggagtgactcagatcgataatgacctaaagtctcgggcg
tctgcatacaataacctgaaagggaatcttcagaatttagagcgaaagaacgcgggaagt
ttgctaacgcgaagcctggcggaaatcgtgaagaaagatgactttgttcttgattcggag
tatcttgtcacattgctggtggtagttcccaagctgaaccacaatgactggattaagcag
tatgaaacgctcgcagaaatggtagtaccaaggtcaagcaatgttctttcagaggaccaa
gacagttatctttgtaacgtcaccttgtttagaaaagcagttgatgatttcagacacaaa
gccagagaaaacaagttcatagttcgtgacttccagtataacgaggaggagatgaaagca
gataaagaagaaatgaccaggctgtctactgacaagaagaagcagtttggaccacttgtg
cggtggcttaaagtgaatttcagtgaggcgtttattgcgtggattcatataaaagcatta
cgggtttttgtggagtctgttttaaggtatggcttgccggtgaacttccaagcaatgctc
cttcagccgaataagaagtcagtgaagaagctaagagaagtgctgcacgagttgtacaag
catctggacagcagtgcggctgccatcattgacgctcccatggatatccctggcctaaac
ctgagtcagcaggaatactacccctatgtgtattacaagattgattgcaacttgctggaa
ttcaagtaa

DBGET integrated database retrieval system