KEGG   Mus musculus (mouse): 66340
Entry
66340             CDS       T01002                                 

Gene name
Psenen, 1700023M09Rik, Pen-2
Definition
(RefSeq) presenilin enhancer gamma secretase subunit
  KO
K06170  presenilin enhancer 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    66340 (Psenen)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66340 (Psenen)
SSDB
Motif
Pfam: PEN-2
Other DBs
NCBI-GeneID: 66340
NCBI-ProteinID: NP_079774
MGI: 1913590
Ensembl: ENSMUSG00000036835
Vega: OTTMUSG00000059364
UniProt: Q9CQR7
Position
7; 7 B1
AA seq 101 aa
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRS
AVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaacttggagcgggtatccaatgaggagaagttgaacctgtgccggaagtactatctt
ggtggatttgcgttcctgccttttctttggttagtcaacattttctggttcttcagagag
gcgttcctcgccccagcctacacagagcagagccaaatcaaaggctatgtttggcgctca
gctgtgggcttcctcttctgggtgatcattctcgccacctggatcaccatcttccagatc
taccggccccgctggggcgctcttggggactacctctccttcaccattcccctgggcact
ccctaa

DBGET integrated database retrieval system