KEGG   Mus musculus (mouse): 66341Help
Entry
66341             CDS       T01002                                 

Gene name
Eid3, 1700027M21Rik, NS4EB
Definition
(RefSeq) EP300 interacting inhibitor of differentiation 3
  KO
K22826  EP300-interacting inhibitor of differentiation 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66341 (Eid3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     66341 (Eid3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nse4_C Nse4-Nse3_bdg BEX ATP-synt_E
Motif
Other DBs
NCBI-GeneID: 66341
NCBI-ProteinID: NP_079775
MGI: 1913591
Ensembl: ENSMUSG00000109864
Vega: OTTMUSG00000060246
UniProt: Q3V124
Position
10; 10 C1
AA seq 375 aa AA seqDB search
MSKEKCSLTGGKEKRGELVRSLAWQHLVKQEEEEAVKKEEKEEGEDEEEEGSDSSSDDPN
PEPPCMHPDLLELVVDREKCRKIRRQYRQLIYTVQQNREDIVNTASDTLSEALEEANVLF
DGVSRTREAALDAQFLVLASDLGKEKAKQLNTDMNFFNPIAFCDLLLLFVGFNWVEEECK
EFSDCDDSIVLSFWGMLHEEATSWMLQAETFHFIFGSFKAERSARKPRLGCHKRACKMEG
SGDMPTKLRRLDVHANQETTEKEVERILGLLQTYFQKYPDTPVSYFEFVIDPNSFSRTVE
NIFYVSFIIRDGFARIRLDQDRLPILEPTNVSQVDDESDSYSYCRKQGVISLSLQDWKNI
VSTFEISEAMIKNSY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatgttcccttactggaggcaaagagaaaagaggggagctggtccgg
agtctggcatggcagcacctggtgaaacaggaggaggaagaggcagtgaagaaggaagaa
aaggaggaaggggaagatgaggaggaggaaggctcagacagtagctccgatgacccgaac
cccgagcccccctgcatgcacccagacctcctggagctggtggtggatcgagagaagtgc
cgcaaaatccgcaggcagtaccggcagctcatctacaccgtgcagcagaaccgcgaggac
attgtgaacacggccagcgacacgctgagtgaggccctggaggaagccaacgtgctgttt
gacggagtgagcagaaccagagaggcagcccttgatgcccagttcctggttttggcctct
gatctgggtaaagagaaggcgaagcagctaaacaccgatatgaacttttttaatcccatt
gccttctgcgatttgctgctgttgtttgtgggcttcaattgggtagaagaggagtgtaag
gaatttagcgactgcgatgatagcatagttctttccttttggggcatgttgcacgaggaa
gcaacctcctggatgctgcaagccgaaacgttccacttcatttttgggtcatttaaggca
gaacgttctgcacgaaagccccggcttggatgtcacaaaagagcttgcaaaatggaagga
agtggagatatgcctacaaagttgaggaggctggatgtgcatgctaatcaggagacgaca
gaaaaagaagttgagagaatcttgggattgctgcaaacctactttcaaaagtaccccgat
actccagtgtcatactttgagtttgtgattgatccaaactcattctctcgcactgtggag
aatatcttctatgtgtcttttattattagggatggctttgcaagaataaggcttgaccaa
gacaggctgccaattctagagccaactaatgtgagccaggtggatgatgaaagtgattcc
tattcgtactgcaggaaacaaggcgttatatctttgagtttacaggactggaaaaatatt
gtctccacttttgaaatttcagaggctatgatcaaaaactcatattaa

DBGET integrated database retrieval system