KEGG   Mus musculus (mouse): 66354
Entry
66354             CDS       T01002                                 

Gene name
Snw1, 2310008B08Rik, AW048543, NCoA, NCoA-62, S, SKIP, SN, Skiip
Definition
(RefSeq) SNW domain containing 1
  KO
K06063  SNW domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04330  Notch signaling pathway
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    66354 (Snw1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    66354 (Snw1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    66354 (Snw1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    66354 (Snw1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    66354 (Snw1)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19-related factors
    66354 (Snw1)
 Complex C
    66354 (Snw1)
SSDB
Motif
Pfam: SKIP_SNW
Other DBs
NCBI-GeneID: 66354
NCBI-ProteinID: NP_079783
MGI: 1913604
Ensembl: ENSMUSG00000021039
UniProt: Q9CSN1 A0A0B4J1E2 Q3TM37 Q9CV75
Position
12; 12 D2
AA seq 536 aa
MALTSFLPAPTQLSQDQLEAEERARSQRSLQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDPEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRKQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcgcctactcagctgtctcaggaccaacttgaagct
gaagaaagggcaagatctcagagatcactgcagacctctctggtctcctctcgaagggag
cctcccccatacggatataggaaaggctggattccaagactattagaggattttggagat
ggaggtgctttcccagaaatccatgtggcccagtatcctctggatatggggcgaaagaaa
aaaatgtcgaatgctctggccattcaggtggatcctgaagggaaaattaagtatgatgca
attgctcggcagggacagtccaaagacaaggtcatttacagcaaatacactgacctggtt
cctaaggaggttatgaatgcagatgacccagacctgcaacggcccgatgaagaggcaatt
aaagagataacagaaaagactagagttgccttggagaaatctgtgtcgcagaaggttgct
gcagccatgccagttcgtgcagctgacaagctggctcctgctcagtatatccgctacaca
ccatctcagcaaggagtagcattcaattctggagctaaacagagggtcattcggatggta
gaaatgcagaaagacccaatggagcctccaagattcaagattaataagaaaattccccgg
ggaccaccgtctcctcctgcacctgtaatgcactctcctagtcggaagatgactgtaaag
gaacaacaagagtggaagatcccgccttgtatttccaactggaagaacgctaaggggtat
acgatcccattagataaacggctggctgctgatggaagaggacttcagactgtccacata
aatgaaaattttgccaaactggctgaagcgctctacattgctgatcggaaggctcgtgaa
gcggtggaaatgcgagcccaggtagagagaaagatggctcaaaaagaaaaggagaaacat
gaagagaaacttagagaaatggcccagaaagccagagaaaggagagctggaatcaaaacc
cacgtggagaaagaggatggagaggcccgtgagagagatgaaatccgtcatgacaggcga
aaagagagacagcatgaccggaacctttccagggcagctcctgataagaggtcaaaacta
cagagaaatgaaaatcgagacatcagtgaagtcattgctcttggtgtgcccaatcctcga
acttccaatgaagttcagtatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggatttgcaggtggagaagatgaaatttacaatgtttatgatcaagcctggagaggtggg
aaagatatggcccagagcatctacaggcccagtaaaaatctggacaaggacatgtatggt
gatgacctggaagccaggataaagaccaacagatttgttcctgataaggagttttctgga
tcagaccgcaaacagagaggccgagaaggaccagtgcagtttgaggaggatccttttggt
ttggacaagtttttggaagaagccaaacagcacggtggttctaaaagaccctctgatagc
agtcgccccaaggaacatgagcatgaaggcaagaagcggaggaaagagtag

DBGET integrated database retrieval system