KEGG   Mus musculus (house mouse): 66357
Entry
66357             CDS       T01002                                 
Symbol
Ostc, 2310008M10Rik, 5730557H03Rik
Name
(RefSeq) oligosaccharyltransferase complex subunit (non-catalytic)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: OST3_OST6
Other DBs
NCBI-GeneID: 66357
NCBI-ProteinID: NP_079785
MGI: 1913607
Ensembl: ENSMUSG00000041084
UniProt: Q78XF5
Position
3:complement(130489566..130503093)
AA seq 149 aa
METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG
SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL
LFIGFVCVLLSFFMARVFMRMKLPGYLMG
NT seq 450 nt   +upstreamnt  +downstreamnt
atggagactctgtaccgagtcccattcttagtgctcgaatgccccaacctgaagctgaag
aaaccgccctgggtgcacatgccgtcggctatgacggtgtacgccctggtagtggtatct
tacttcctcattaccggaggaataatctatgatgttatcgttgaacctccaagtgttggc
tcaatgaccgatgaacatgggcatcagagaccagtagctttcttggcttacagagtaaac
ggacagtatatcatggaagggcttgcgtccagctttctctttacaatgggaggtttaggt
ttcataatcctggaccgatccaatgcaccaaacataccgaaactcaacaggtttcttctt
ctgttcatcggcttcgtctgtgttctcctgagtttcttcatggccagagtgttcatgaga
atgaaattgccgggctacctgatgggctag

DBGET integrated database retrieval system