KEGG   Mus musculus (house mouse): 66361
Entry
66361             CDS       T01002                                 
Symbol
Zfand1, 2310008M20Rik, AW048890
Name
(RefSeq) zinc finger, AN1-type domain 1
  KO
K24684  AN1-type zinc finger protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    66361 (Zfand1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  AN1-type zinc finger domain-containing proteins
   66361 (Zfand1)
SSDB
Motif
Pfam: zf-AN1 zf-C5HC2 Transp_Tc5_C
Other DBs
NCBI-GeneID: 66361
NCBI-ProteinID: NP_079788
MGI: 1913611
Ensembl: ENSMUSG00000039795
UniProt: Q8BFR6
Structure
Position
3:complement(10405016..10416412)
AA seq 268 aa
MAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHK
SYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVRDIVD
AKTGGAASKGRKGAKSSGTAAKVALMKLKMHADGDKSLPQTERTYFQVYLPKGSKEKSKA
MFFCLRWSIGKVVDFAASLANLRNENNKLTAKKLRLCHVPSGEALPLDHTLERWITKEEC
PLYNGGNVILEYLNDEEQFLKNVDSYLE
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcggagttggacattgggcagcactgccaggtgcagcactgccggcagcgagatttt
cttccatttgtgtgtgatggttgttcaggaatattttgccttgaacacagaagcaaggac
tctcatggttgttctgaggtgaatgtagtcaaggagagaccaaagacagatgaacacaaa
tcttactcatgctctttcaagggctgcactgacgtagagcttgtggcagtgatctgtcct
tactgtgagaagaacttttgcctgagacaccgtcatcagtcggatcatgactgtgaaaag
ctggaagtcgcaaagcctcgaatggctgccacacagaaacttgtcagagacattgtcgat
gccaagacaggaggggcagcaagtaagggacggaaaggcgcaaaaagtagcggaacagcg
gcgaaggtggcgctgatgaagctaaagatgcacgctgatggggataagtccctgccgcag
acagaaagaacatacttccaggtctacttgccaaaggggagcaaggaaaaaagcaaagcc
atgttcttttgcctgcggtggagcatcgggaaggttgtggactttgcagcttctctcgct
aatctcaggaatgaaaacaacaagctgacagcgaagaagctgaggctgtgtcatgtccct
tcaggagaagccctgccattggatcacacattggaaaggtggatcacgaaggaggagtgc
cctttatataatggaggaaatgttatcttggaatatcttaacgatgaagaacagttttta
aaaaatgttgactcttacttggaatag

DBGET integrated database retrieval system