KEGG   Mus musculus (mouse): 66366Help
Entry
66366             CDS       T01002                                 

Gene name
Ergic3, 2310015B14Rik, AV318804, CGI-54, D2Ucla1, NY-BR-84, Sdbcag84
Definition
(RefSeq) ERGIC and golgi 3
  KO
K20367  endoplasmic reticulum-Golgi intermediate compartment protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66366 (Ergic3)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    66366 (Ergic3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPIIcoated_ERV ERGIC_N
Motif
Other DBs
NCBI-GeneID: 66366
NCBI-ProteinID: NP_079792
MGI: 1913616
Ensembl: ENSMUSG00000005881
Vega: OTTMUSG00000016019
UniProt: Q9CQE7
Position
2 H1; 2 77.32 cM
AA seq 383 aa AA seqDB search
MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV
DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGVPVSSEAE
RHELGKVEVTVFDPNSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIE
QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI
NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF
SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG
LIDSLIYHSARAIQKKIDLGKTT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctggggaagctgaagcagttcgatgcctaccctaagactctggaggacttc
cgggtcaagacctgcgggggtgccacggtgaccatcgtcagtggccttctcatgctcctg
cttttcctatcggagttgcagtattatctcactacggaggtgcatcctgagctctacgtg
gacaagtctcggggggataaactgaagatcaacatcgatgttcttttcccgcacatgcct
tgtgcctacttgagcatcgatgccatggacgtggccggggagcagcagctggatgtggaa
cacaacctgttcaagaaacgactagacaaggatggcgtccccgtgagctcagaggctgaa
cggcacgagcttgggaaagtcgaggtgacagtgtttgaccccaactccttggaccccaat
cgctgtgagagctgctacggcgctgagtcagaagacatcaagtgctgtaacagttgtgaa
gatgtgcgggaggcctatcgccgtcgaggctgggccttcaagaacccggacaccattgag
cagtgtcggcgagagggcttcagccagaagatgcaggagcagaagaatgaaggctgccag
gtgtacggcttcttggaggtcaacaaggtggctggaaacttccactttgcccctgggaag
agcttccaacagtctcatgtgcatgttcatgacttgcagagctttggccttgacaatatc
aacatgacacactacatcaagcacctgtcattcggggaggactatccaggaatcgtgaac
cccctagaccacaccaacgtgactgcaccccaagcctccatgatgttccagtactttgtg
aaggtggtgcccacagtgtacatgaaggtggacggggaggtgctgaggactaaccagttc
tccgtgaccaggcacgagaaggttgccaatgggctcctgggtgaccagggcctgccgggg
gtctttgtgctgtatgagctctcaccaatgatggtgaagctgacggagaaacacaggtcc
ttcacccactttctgacaggtgtgtgcgccatcattgggggcatgtttacagtggccggc
ctcattgactcgctcatctaccactccgctcgggccatccagaagaaaattgacctaggg
aagacaacgtag

DBGET integrated database retrieval system