KEGG   Mus musculus (mouse): 66367Help
Entry
66367             CDS       T01002                                 

Gene name
2310022A10Rik
Definition
(RefSeq) RIKEN cDNA 2310022A10 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5577 SAM_4 SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 66367
NCBI-ProteinID: NP_780316
MGI: 1913617
Ensembl: ENSMUSG00000049643
Vega: OTTMUSG00000046071
UniProt: Q8R3Y5 G5E8E3
Position
7; 7 A3
AA seq 413 aa AA seqDB search
MGFRIGENLLFNLRKAPGSRVKARKTMVSVTMATSEWIQFFKEAGIPPGPAVNYAVMFVD
NRIQKSMLLDLNKEIMNELGVTVVGDIIAILKHAKVVHRQDMCKAATESVPCNPSPLQGE
LRRGASSAASRMIANSLNHDSPPHTPTRRSDNSTSKISVTVSNKMAAKSAKAAALAHREE
ESLVVPTKRRRVTAEMEGKYIIHMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAESKA
DTTTGTKPTGVFSRLGATPEMDEDLAWDSDNDSSSSSVLQYAGVLKKLGRGPTKASAQPA
LTVKAKATSSATTTATTPKLRRLALPSRPGLEKKPDSLPKVSILQRLGKAAVVSEAQDSQ
VTSTKSKSSAEVKFAIKRTLVGPRGSSSSESLGAQMDHAGTVSVFKRLGQRTF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcagaatcggagagaacttgcttttcaatctcagaaaggctccaggaagcagg
gtcaaggccaggaagacgatggtctcagtgactatggccacttccgagtggatccagttc
ttcaaggaagccggcattcccccaggacctgctgttaattacgctgtgatgtttgtggat
aatcggatccagaagagcatgctgctagatcttaataaagaaatcatgaacgagctgggt
gtgaccgtcgtgggtgatatcattgccatcctcaagcatgccaaggtggtacaccgccag
gacatgtgcaaagcagccactgagtcagtgccctgcaaccccagcccgctccagggtgag
cttcgccgaggcgcttctagtgccgcttctcgaatgattgccaacagcctgaaccatgac
tctccaccccatacccccacacggcggtcagacaacagcacctccaagatctccgtcact
gtgtccaacaagatggcagcgaagagtgccaaggctgccgctctggcccacagggaggag
gaaagcctggttgttcccaccaagcggcggcgggtcacggctgagatggagggaaagtac
atcatccacatgcccaaggggaccacgccccgcacccggaagatcctggagcagcagcag
gcagcaaaaggtctccatagaacatctgtgtttgatcgccttggtgctgagtccaaagca
gacacgaccacagggactaagcccacaggagttttcagccgcttaggggccaccccagag
atggatgaggatctggcctgggacagtgacaatgacagcagcagtagctctgtcctgcag
tatgctggggtcctgaagaaactaggacgaggcccaaccaaggccagtgcccaaccagca
ctgactgtcaaagccaaggccacaagctctgcaaccaccacagctaccactccaaagctg
cggcgcctggcacttccctctcgccctgggctggagaagaagccggattccctgcccaaa
gtcagcatccttcagagactgggcaaggctgccgttgtgtccgaggcacaggacagccag
gtcacaagcaccaagagtaagtcctcagctgaggtcaagttcgccattaaaaggactctg
gtagggccccgggggagcagctccagcgagagccttggtgcccagatggaccatgcaggc
actgtgagcgtgttcaaaagactgggccaaaggactttctag

DBGET integrated database retrieval system