KEGG   Mus musculus (mouse): 66368
Entry
66368             CDS       T01002                                 

Gene name
Rtca, 2310009A18Rik, AI450277, RPC, Rtcd1
Definition
(RefSeq) RNA 3'-terminal phosphate cyclase
  KO
K01974  RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    66368 (Rtca)
Enzymes [BR:mmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.4  RNA 3'-terminal-phosphate cyclase (ATP)
     66368 (Rtca)
SSDB
Motif
Pfam: RTC RTC_insert
Other DBs
NCBI-GeneID: 66368
NCBI-ProteinID: NP_079793
MGI: 1913618
Ensembl: ENSMUSG00000000339
Vega: OTTMUSG00000027075
UniProt: Q9D7H3
Position
3; 3 G1
AA seq 366 aa
MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMVR
DLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVCLLMQVSMPCVLFAASPSELR
LKGGTNAEMAPQIDYTMMVFKPIAEKFGFTFNCDIKTRGYYPKGGGEVIVRVSPVKRLDP
INLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIRKEIRDLYVSIQPVQEARDQAF
GNGSGIIIVAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLI
IFMALANGISRIKTGSVTLHTQTAIHFAEQLAKAKFTVKKSEEEEDATKDTYVIECEGIG
MANPHL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggagggccagcgggtggaggtggacggtgggatcatggaagggggcggccagatcctc
agggtctccaccgccctgagctgcctcctgggcctacccttgcgcgtgcagaagatccgc
gcgggccgcagcacgccgggcctcaggcctcagcatttatctggactggaaatggttcgt
gatttgtgtggcgggcacctggagggagcagaaatcggctcaacagagataacctttacc
cccgagaagatcagaggtggagtccacacggcagataccaagacagcagggagtgtgtgc
ctcttgatgcaggtttcaatgccctgtgtcctgtttgcggcttccccgtcggagctccgt
ctgaaaggcggcaccaatgcggagatggccccgcagatcgattacaccatgatggttttc
aagccaattgctgagaagtttggtttcacatttaattgtgacattaaaacgaggggctat
taccccaaagggggtggtgaagtgattgtccgagtgtccccagttaaacgattggaccca
ataaatctgactgatcgaggctctgtgaccaagatttatgggagagcttttgttgccggt
gttttgccactaaaagtagcaaaagatatggcggcggcggctgtgcggtgcatccggaag
gagatccgggatctgtacgtcagcatccagcccgtgcaggaggccagggaccaagccttc
ggcaatgggagtggaatcatcattgttgctgagacatccactggctgcttgtttgctgga
tcatcacttggcaaaagaggtgtgaatgcagacaaggttgggattgaagctgctgaaatg
ctattagcgaaccttagacacggtggcactgtggatgagtatctacaagaccagctgatt
attttcatggcgctagccaatggaatttccagaataaaaacaggatcagtcacactccac
acgcagactgctatacattttgctgaacagctagcaaaggccaaatttaccgtgaagaaa
tcagaagaggaagaagatgccactaaggacacttacgtcatcgagtgtgaaggaattggg
atggcaaatccacacctctag

DBGET integrated database retrieval system