KEGG   Mus musculus (mouse): 66374Help
Entry
66374             CDS       T01002                                 

Gene name
2310011J03Rik, AI452186, AW545358
Definition
(RefSeq) RIKEN cDNA 2310011J03 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0449 OmpH
Motif
Other DBs
NCBI-GeneID: 66374
NCBI-ProteinID: NP_079797
MGI: 1913624
Ensembl: ENSMUSG00000020133
Vega: OTTMUSG00000019117
UniProt: Q9D7E4
Position
10; 10 C1
AA seq 109 aa AA seqDB search
MNSKAKKRVVLPTRPAPPTVEQILEDVRGAPAQDPVFTALAPEDPPDPSPRAEDSEIQQE
QIYQQSRAYVAMNERLRQAGEALRQKFDGLRQAGQRLEQDISQVTSATS
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaaggcgaagaaacgcgtggtactgcccactcgccccgcgcctcccacggtg
gagcagatcctggaggacgtgcgaggggcacccgctcaagatcctgttttcactgccctg
gccccggaagaccccccagacccatccccaagggctgaggactctgagatccagcaggag
cagatctaccaacagagccgggcctacgtggctatgaatgagaggctgcggcaggcgggg
gaagctctgagacagaagttcgatggccttcggcaagctggtcagcggctggaacaggat
atcagccaggtgacttcagccacctcctag

DBGET integrated database retrieval system