KEGG   Mus musculus (mouse): 66375
Entry
66375             CDS       T01002                                 

Symbol
Dhrs7, 2310016E22Rik, 5730564L20Rik, AW061210, Retdsr4, Retsdr4, retD, retS
Name
(RefSeq) dehydrogenase/reductase (SDR family) member 7
  KO
K11165  dehydrogenase/reductase SDR family member 7 [EC:1.1.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    66375 (Dhrs7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     66375 (Dhrs7)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 2-Hacid_dh_C Epimerase
Other DBs
NCBI-GeneID: 66375
NCBI-ProteinID: NP_079798
MGI: 1913625
Ensembl: ENSMUSG00000021094
UniProt: Q9CXR1
Position
12; 12 C3
AA seq 338 aa
MSWELLLWLLALCALILPLVQLLRFLRADADLTLLWAEWQGRRPEWELTDMVVWVTGASS
GIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNLKEKDILVLPLDLTDTSSHEA
ATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIER
KQGKIVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSELGQYPGITFCNVYPGPVQSD
IVKNAFTEEVTKSMRNNIDQSYKMPTSRCVRLMLISMANDLKEVWISDHPVLLGAYIWQY
MPTWAAWLNCKLGKERIQNFKNNLDPDLPYKFLKAKKD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagctgggagctgctgttgtggctgctggcgctgtgcgcgctgatcctgccccttgtg
cagctcttgcgctttttgcgggcggatgcggacctgaccttgttgtgggctgaatggcaa
gggcgacgcccagaatgggagctgactgacatggtggtgtgggttactggagcgtcaagt
ggcattggcgaggagctagctttccagttatctaaactcggggtctctctggtgctgtca
gcccgaagggcgcaggagctggagcgggtgaagagaagatgcctggaaaatggcaattta
aaagaaaaagatatactggttctgccccttgacttgaccgatacaagttcccatgaggca
gccaccaaagccgttctgcaggagtttggtaaaattgacattttggtcaacaacggtgga
agaagccagcgttccttagttctagaaaccaacttggatgtcttcaaggagctgataaat
ctgaactacatagggacagtatccttgaccaagtgtgtcctgcctcacatgatagagagg
aaacaagggaagattgtgactgtgaacagcatcgcggggattgcctctgtgtccctttcc
agtggctactgtgccagcaagcatgctcttcggggttttttcaatgccctccatagtgag
ctcggccaatatccaggcataacattttgcaacgtttacccggggcctgtgcagtccgac
attgtgaagaatgccttcaccgaggaagtaactaagtctatgagaaacaacatagaccag
agttacaagatgccaacgagccgctgtgtgcggctgatgctcatctccatggccaatgat
ctgaaggaagtctggatctctgaccatcctgtgctgttgggggcatacatatggcagtat
atgccaacctgggccgcatggctaaactgcaagttggggaaggaaagaatccaaaacttt
aagaataatttggatccagacttgccttataaattcttgaaggcaaagaaggattga

DBGET integrated database retrieval system