KEGG   Mus musculus (mouse): 66383
Entry
66383             CDS       T01002                                 

Gene name
Iscu, 2310020H20Rik, AA407971, ISCU2, Ni, Nifu, Nifun
Definition
(RefSeq) iron-sulfur cluster assembly enzyme
  KO
K22068  iron-sulfur cluster assembly enzyme ISCU, mitochondrial
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66383 (Iscu)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    66383 (Iscu)
SSDB
Motif
Pfam: NifU_N
Other DBs
NCBI-GeneID: 66383
NCBI-ProteinID: NP_079802
MGI: 1913633
Ensembl: ENSMUSG00000025825
Vega: OTTMUSG00000025818
UniProt: Q9D7P6
Structure
PDB: 
1WFZ

Position
5; 5 F
AA seq 168 aa
MAAATGAGRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNV
GTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALT
IKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQESKKEEPEKQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcggcggccacgggagctggccgtctgaggcgggcggcgtcggcgctgctgctgcgg
agcccgcgcctgcccgcccgggagctgtcggctccggccaggctctaccacaagaaggtt
gtggatcattatgaaaaccctcggaacgtgggatcccttgacaagacatctaaaaatgtt
ggaaccggattggtgggggctccggcatgtggtgacgtcatgaaactgcagatccaggtg
gatgaaaaggggaagattgtggacgccagattcaaaacatttggctgcggctccgccatt
gcctccagctccttagccacagagtgggtaaaggggaaaacggtggaggaagccctgacc
atcaaaaacaccgacatcgccaaggagctctgcctgccgcctgtgaaactgcactgctcc
atgctggcagaagacgccatcaaggccgccctggctgactacaaactgaagcaagagtcc
aagaaggaggagccagagaagcagtga

DBGET integrated database retrieval system