KEGG   Mus musculus (mouse): 66387Help
Entry
66387             CDS       T01002                                 

Gene name
Nudt8, 2310039H17Rik
Definition
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 8
  KO
K18665  nudix motif 8 [EC:3.6.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    66387 (Nudt8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     66387 (Nudt8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 66387
NCBI-ProteinID: NP_079805
MGI: 1913637
Ensembl: ENSMUSG00000110949
Vega: OTTMUSG00000063565
UniProt: Q9CR24
Position
19; 19 A
AA seq 210 aa AA seqDB search
MLPDGLSAEDEQRCRQLLARTTARLRSRPAAAAVLVPLCLVRGVPALLYTLRSSRLVGRH
KGEVSFPGGKCDPDDQDVIHTALRETQEELGLEVPKEHVWGVLQPVYDREKATIVPVLAN
VGPLDLQSLRPNLEEVDEVFEMSLAHLLQTQNQGYTHFCQGGHFSYTLPVFLHGPHRVWG
LTAVITELTLKLLAPGFYQPSLAVPELPRG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgatggcctgtccgcggaggacgagcagcgctgccggcagctgctagcacgg
accactgcccggttacgctcgcggcccgcagcggccgcagtgcttgtgccgctgtgcctc
gtgcgcggggtccccgcgttgctctacacgctgcgttctagtcgcctggttgggagacac
aaaggggaagtcagtttcccaggcggtaagtgtgatcccgacgaccaagatgtaatacat
acggcccttcgggagactcaggaggagctgggcctagaggtgcccaaggagcacgtgtgg
ggtgtcctgcagccagtgtatgaccgggaaaaggcaaccatagtcccagtacttgccaac
gtgggcccactggatctgcagagccttaggcccaaccttgaggaggtggatgaagtattt
gagatgtctctggcccacttgctgcagacacagaaccaggggtatacccacttctgccag
ggtggccacttcagctacacactgcctgtcttcttgcatggaccacaccgtgtctggggc
ctcacagctgtcatcactgagctcaccctgaagctgctggcccctggcttctaccagccc
tccctagctgttcctgagctgcctaggggttga

DBGET integrated database retrieval system