KEGG   Mus musculus (mouse): 66395Help
Entry
66395             CDS       T01002                                 

Gene name
Ahnak, DY6
Definition
(RefSeq) AHNAK nucleoprotein (desmoyokin)
  KO
K23934  neuroblast differentiation-associated protein AHNAK
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    66395 (Ahnak)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_2 PDZ_6 GRASP55_65 DUF3394
Motif
Other DBs
NCBI-GeneID: 66395
NCBI-ProteinID: NP_001035048
MGI: 1316648
Ensembl: ENSMUSG00000069833
UniProt: Q8BRB8 G5E8K8 Q8R2L7
Position
19; 19 A
AA seq 150 aa AA seqDB search
MEKEEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVMQNSPAARTGVVKEGDQIVGAT
IYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTHEVFSSRSSEVVLNTVQP
SSLDCNDQNKPKEAINKAGAASDSTPDAGL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggaggaagagacaacccgggagctgctgctgcccaactggcagggcagtggt
tcccacgggctgaccattgcccagagggatgatggagtctttgttcaggaggtgatgcag
aactcccctgcggcccgcactggggtggtcaaggagggggaccagattgtgggtgccacc
atctactttgacaacctgcagtctggtgaggtgacccagttgctgaataccatggggcat
cacactgttggcttgaagttgcaccgtaaaggggaccgttcccctgagcctggacagacc
tggacccatgaagtcttcagttcccgtagctctgaagtggttctgaacacggtacaacct
tcatccctggactgcaatgaccagaataaacccaaggaagctatcaacaaagctggggca
gcatcagactccaccccagatgcagggctgtag

DBGET integrated database retrieval system