KEGG   Mus musculus (house mouse): 66401
Entry
66401             CDS       T01002                                 
Symbol
Nudt2, 2310051L06Rik, AA939917, APAH1
Name
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 2
  KO
K01518  bis(5'-nucleosidyl)-tetraphosphatase [EC:3.6.1.17]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    66401 (Nudt2)
   00240 Pyrimidine metabolism
    66401 (Nudt2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.17  bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
     66401 (Nudt2)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 66401
NCBI-ProteinID: NP_079815
MGI: 1913651
Ensembl: ENSMUSG00000028443
UniProt: P56380 Q3V1C8
Position
4:41465085..41480926
AA seq 147 aa
MALRACGLIIFRRHLIPKMDNSTIEFLLLQASDGIHHWTPPKGHVDPGENDLETALRETR
EETGIEASQLTIIEGFRRELNYVARQKPKTVIYWLAEVKDYNVEIRLSQEHQAYRWLGLE
EACQLAQFKEMKATLQEGHQFLCSTPA
NT seq 444 nt   +upstreamnt  +downstreamnt
atggccctgagggcatgtggcttgatcatcttccgaagacaccttattcccaagatggac
aacagtacaattgaatttctgctgctgcaggcatcagacggcattcatcactggactcct
cccaaaggccatgtggacccaggagagaatgacttagaaacagccctgcgagagactcgg
gaggaaacaggcatagaagcaagccaactgaccatcattgaggggttcagaagggagctc
aattacgtggccaggcagaagcctaaaacggtcatttactggctggcagaagtgaaagac
tacaatgtagagatccgcctctcccaggagcatcaagcctaccgctggctggggctggag
gaggcctgccagttggctcagttcaaggagatgaaggcaacactccaagaaggacaccag
tttctctgctccacaccggcctga

DBGET integrated database retrieval system