KEGG   Mus musculus (mouse): 66404
Entry
66404             CDS       T01002                                 

Symbol
Rtf2, 1700067C04Rik, 2410001C21Rik, 5730427M17Rik, AA589417, Rtfdc, Rtfdc1
Name
(RefSeq) replication termination factor 2
  KO
K25186  replication termination factor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    66404 (Rtf2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    66404 (Rtf2)
SSDB
Motif
Pfam: Rtf2 zf-NOSIP
Other DBs
NCBI-GeneID: 66404
NCBI-ProteinID: NP_079818
MGI: 1913654
Ensembl: ENSMUSG00000027502
Vega: OTTMUSG00000016150
UniProt: Q99K95
Position
2; 2 H3
AA seq 307 aa
MGCDGGTIPKRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEILRRPIVACELGRLYNKD
AVIEFLLDKSAEKALGKAASHIRSIKNVTELRLSDNPAWEGDKGNTKGDKHDDLQRARFI
CPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEEDIIVLNGTKEDVE
MLKKRMEERRLRAKLEKKTKKPKTATECASKPGTTQDSAGPSKVKSGKPEEADPDPREKK
STPAPRGAATNGSASGKVGKPPCGALKRSIADSEESETYKSIFTSHSSAKRSKEESAHWV
THTSYCF
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggttgcgacggaggcaccatccccaagaggcacgagctggtgaaggggccgaagaag
gtcgagaaggttgacaaagacgctgaactggtagcccaatggaactactgtaccctaagt
caggaaatcctgaggcgcccaatagttgcctgtgagcttggcagactgtataacaaagac
gcggtcatcgagtttctgttggacaaatctgctgagaaggccctggggaaggcggcatcg
cacatcagaagcatcaagaatgtgacagagctcaggctttctgacaaccccgcctgggaa
ggagataaagggaacaccaagggcgacaagcatgatgacctccagagagcgcggttcatc
tgccctgtggtgggcctggagatgaatggccggcacaggttttgcttcctccgatgctgc
ggttgtgtgttttctgaacgcgccttgaaggagataaaagctgaagtgtgtcacacgtgt
ggggctgccttccaggaggaggacatcattgtgctcaatggcaccaaggaggatgtggag
atgctgaagaagaggatggaggagaggaggctgagggccaagctggaaaagaaaacaaag
aaaccgaagacagcgaccgagtgtgcgtcaaagccgggtaccacacaagattccgcaggg
ccatcaaaagtgaagtctggcaagcctgaggaggcggaccctgatcctagagagaagaaa
agcaccccggctcccaggggcgcagcaactaatgggagtgcgtctgggaaagttggcaag
cccccatgtggggccctgaagaggtccattgcagacagcgaggagtctgaaacctacaag
tctatcttcaccagccacagctctgccaagcgctccaaggaggagtctgcgcactgggtc
acccacacatcctactgcttctga

DBGET integrated database retrieval system