KEGG   Mus musculus (house mouse): 66407
Entry
66407             CDS       T01002                                 
Symbol
Mrps15, 1500003E24Rik, 2410002B11Rik, Mprs15
Name
(RefSeq) mitochondrial ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    66407 (Mrps15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    66407 (Mrps15)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    66407 (Mrps15)
  Bacteria
    66407 (Mrps15)
  Archaea
    66407 (Mrps15)
SSDB
Motif
Pfam: Ribosomal_S15 DUF272
Other DBs
NCBI-GeneID: 66407
NCBI-ProteinID: NP_079820
MGI: 1913657
Ensembl: ENSMUSG00000028861
UniProt: Q9DC71
Position
4:125940721..125949329
AA seq 258 aa
MLRAAWRALSSVRAQAVTRAPVPALRGGSSASLLSARCGLQPPSLLRAARAYAAVQKPVQ
PKQDDEPPSSAFIKEYKDIIPNIEKVDDVVKRILSLEMASRKEKLKIKQEQLMNKIVENP
EDSRTLEAQIIALTVRIRNYEEHMQKHRKDKAHKRHLLMSIDRRKKLLKILRQTNYDVFE
KTCKELGVEYTLPPLHFQKVHRRFLAKKALCIRVYQEVQKLKKQKRALKAAAAAAKKEKN
EGVPENPSNAVPEKTQVN
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctgcgggccgcgtggcgtgcgctgagctctgttcgtgcccaggcggtgacacgggcc
ccagtccctgcgctgaggggcggaagtagcgccagtctgctctctgcgcgctgtggcctg
cagcctccgagtctactgcgcgccgcgcgagcatacgccgccgtccagaaaccagtccaa
cccaagcaggacgatgaaccaccctcctctgcgttcatcaaagaatacaaggacatcatc
cccaacatagagaaggttgatgatgttgtgaaaagaatcttgtctttggaaatggccagc
aggaaagagaagttaaaaatcaagcaagaacaattgatgaacaagattgtggaaaaccct
gaggattccagaaccttggaagctcaaatcattgccttgactgtcaggatccgcaattat
gaagaacacatgcagaaacatcgaaaggacaaagcccacaaacgccatctgctgatgagc
atcgaccggaggaaaaagttgctcaaaatcctccgtcagaccaactatgatgtcttcgaa
aagacatgcaaggagctaggggtggaatataccttaccccctctgcatttccaaaaggtt
caccgccgcttcctggccaagaaggctctgtgcattcgggtttaccaggaggtgcaaaag
ctgaagaagcaaaaaagggccttaaaagctgctgcagctgctgccaaaaaagaaaaaaat
gagggggtgccagagaacccttcaaatgccgtaccagagaagacccaagtgaactaa

DBGET integrated database retrieval system