KEGG   Mus musculus (mouse): 66414
Entry
66414             CDS       T01002                                 

Gene name
Ndufa12, 2410011G03Rik, AW112974, CI-B17.2, CIB17.2
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66414 (Ndufa12)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66414 (Ndufa12)
  09159 Environmental adaptation
   04714 Thermogenesis
    66414 (Ndufa12)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    66414 (Ndufa12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66414 (Ndufa12)
   05012 Parkinson disease
    66414 (Ndufa12)
   05014 Amyotrophic lateral sclerosis
    66414 (Ndufa12)
   05016 Huntington disease
    66414 (Ndufa12)
   05020 Prion disease
    66414 (Ndufa12)
   05022 Pathways of neurodegeneration - multiple diseases
    66414 (Ndufa12)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66414 (Ndufa12)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66414 (Ndufa12)
SSDB
Motif
Pfam: NDUFA12
Other DBs
NCBI-GeneID: 66414
NCBI-ProteinID: NP_079827
MGI: 1913664
Ensembl: ENSMUSG00000020022
Vega: OTTMUSG00000030989
UniProt: Q7TMF3 A0A0R4J275
Structure
PDB: 
6G2J 6G72

Position
10; 10 C2
AA seq 145 aa
MELVEVLKRGVQQVTGHGGLRGLLRVFFRANDIRIGTLVGEDKYGNKYYEDNKQFFGRHR
WVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTTNPPTARKFIWTNHKFNVSAT
PEQYVPYSTTRKKIHEWVPPSTPYK
NT seq 438 nt   +upstreamnt  +downstreamnt
atggagctggtggaggtcctgaagcgcggcgtgcagcaggtcaccggccacggcggcctg
cggggcctcctacgggttttcttcagggcaaatgatataaggattggtacactggtggga
gaagacaaatatggaaataaatactacgaagacaacaagcaattttttggccgccaccga
tgggtcatctacaccaccgagatgaacggcaaaaacacattctgggatgtggatggaagc
atggtgcctcctgagtggcaccgctggcttcactgcatgactgacgaccctccgacgact
aatccaccgactgctcgtaaattcatctggacaaaccataaattcaatgtgtctgccact
ccagagcaatacgttccttattccaccactagaaagaagattcatgaatgggttccacct
tcgacaccttacaagtga

DBGET integrated database retrieval system