KEGG   Mus musculus (mouse): 66420
Entry
66420             CDS       T01002                                 

Gene name
Polr2e, 2410021N14Rik, 25kD, 25kDa, AW208866, RP, RPB5, XA, XAP4
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide E
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    66420 (Polr2e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    66420 (Polr2e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    66420 (Polr2e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    66420 (Polr2e)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66420 (Polr2e)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     66420 (Polr2e)
  RNA polymerase III system
   RNA polymerase III
     66420 (Polr2e)
  RNA polymerase I system
   RNA polymerase I
     66420 (Polr2e)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      66420 (Polr2e)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Other DBs
NCBI-GeneID: 66420
NCBI-ProteinID: NP_079830
MGI: 1913670
Ensembl: ENSMUSG00000004667
Vega: OTTMUSG00000019133
UniProt: Q80UW8 Q3V214
Position
10; 10 C1
AA seq 210 aa
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atggacgacgaggaggagacctaccggctgtggaagatccgcaagacgatcatgcagctg
tgtcatgaccgtggctacctggtgacccaggatgaactggaccagacacttgaggaattc
aaggcgcagtttggggacaagcccagcgaaggacggccaaggcgcacagacctcacggtg
ctggtggcccacaacgatgaccccacagaccagatgtttgtgttcttcccagaggagccc
aaggtgggcatcaagaccatcaaggtatactgccagcgcatgcaggaggaaaacatcaca
cgggcgctgattgtggtgcagcagggcatgacgccctccgccaagcagtccctggtggac
atggccccgaagtatgtgctggaacagtttctacagcaggagctgctcatcaatatcaca
gagcacgagctagtccctgagcacgtggtcatgacaaaggaggaggtgactgaactgctg
gctcgatacaagcttcgtgagagccagctacccagaatccaggccggggacccagtggca
cggtactttgggatcaagcgagggcaggtcgtgaagatcatccgccccagtgagacggct
ggccgctacatcacctaccgcctggtgcagtag

DBGET integrated database retrieval system