KEGG   Mus musculus (house mouse): 66423
Entry
66423             CDS       T01002                                 
Symbol
Coprs, 1700029I03Rik, 2410022L05Rik, AA409325, AI256813, C85432, Copr5
Name
(RefSeq) coordinator of PRMT5, differentiation stimulator
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: COPR5
Other DBs
NCBI-GeneID: 66423
NCBI-ProteinID: NP_079832
MGI: 1913673
Ensembl: ENSMUSG00000031458
Vega: OTTMUSG00000060790
UniProt: Q9CQ13
Position
8:complement(13934787..13940501)
AA seq 173 aa
MDPQAATGRGPGERSSQEAPSAEAGFATADLSGRETETELAVDRLASGAQSIPADIPAHA
EGPSSEEEGFAVEKEADGELYAWELSEGPSCPPMEQAADLFNEDWDLELKADQGNPYDAD
DIQGSISQEIKPWVCCAPQGDMIYDPSWHHPPPLIPHYSKMVFETGQFDDAED
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaccctcaggcagccaccggtcggggcccgggcgagcggagttcgcaggaggccccc
agcgcggaggctggctttgccacagctgacctctctggtcgggagacggagactgagctg
gccgtggatcgactagccagtggagctcagagcatccctgctgacattcctgcccatgcc
gagggcccaagttctgaggaggaaggctttgcagtggagaaggaagctgatggggagttg
tatgcctgggagctgtcagagggtccatcctgcccacccatggaacaggctgcagatctt
tttaatgaggactgggacttggagctgaaagcagaccaaggaaatccttacgatgctgat
gacatccaggggagcatttcccaagagatcaagccttgggtgtgctgtgcaccacaggga
gacatgatatacgaccccagttggcaccatccacctccactcataccacactactccaag
atggtcttcgaaacaggacagtttgatgatgccgaagactag

DBGET integrated database retrieval system