KEGG   Mus musculus (mouse): 66437Help
Entry
66437             CDS       T01002                                 

Gene name
Fis1, 2010003O14Rik, Ttc11
Definition
(RefSeq) fission, mitochondrial 1
  KO
K17969  mitochondrial fission 1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    66437 (Fis1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66437 (Fis1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    66437 (Fis1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fis1_TPR_C Fis1_TPR_N TPR_2 ANAPC3 COPI_C
Motif
Other DBs
NCBI-GeneID: 66437
NCBI-ProteinID: NP_079838
MGI: 1913687
Ensembl: ENSMUSG00000019054
Vega: OTTMUSG00000023394
UniProt: Q9CQ92
Structure
PDB: 

Position
5; 5 G2
AA seq 152 aa AA seqDB search
MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtgctgaacgagctggtgtctgtggaggatctgaagaattttgaaaggaaa
tttcagtctgagcaggcagctggttctgtgtccaagagcacgcaatttgaatatgcctgg
tgcctggttcgaagcaaatacaatgaggacatccgcagaggcatcgtgctgctggaggag
ctgttgcccaaagggagcaaagaggaacagcgggactatgtcttctacctggccgtgggc
aactaccggctcaaggaatatgaaaaggctctaaagtatgtgcgagggctgttgcagact
gagccccagaacaaccaggccaaggagctggaacgcctgattgataaggccatgaagaaa
gatggactggtaggcatggccatcgttggtggcatggccctgggcgtggcaggcctggct
ggactcattggactggctgtctccaagtccaaatcctga

DBGET integrated database retrieval system