KEGG   Mus musculus (mouse): 66439
Entry
66439             CDS       T01002                                 

Symbol
Borcs7, 2010012O05Rik, 4930569L17Rik, AI413851, AI467257
Name
(RefSeq) BLOC-1 related complex subunit 7
  KO
K20821  BLOC-1 related complex subunit 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66439 (Borcs7)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    66439 (Borcs7)
SSDB
Motif
Pfam: BORCS7
Other DBs
NCBI-GeneID: 66439
NCBI-ProteinID: NP_079839
MGI: 1913689
Ensembl: ENSMUSG00000062376
UniProt: Q9CRC6
Position
19; 19 C3
AA seq 105 aa
MATGTPDSQARFGQSVKGLLTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQED
AILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSPDLQDQLSHLLK
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcgactgggacgccggattcgcaagcccgatttggtcagtccgtgaaggggcttctc
acggagaaggtgaacacctgtggcaccgatgtaatcgcgctcaccaagcaggtgctgaaa
ggctcgcggagctccgagctgctggggcaggcagctcgaaacatggtactacaggaagat
gccatcttacactcggaagatagtttaaggaagatggcaataataacaacacaccttcag
taccagcaagaagctattcagaagaatgtggaacagtcgcctgacctgcaggaccagttg
agtcacttactgaagtag

DBGET integrated database retrieval system