KEGG   Mus musculus (house mouse): 66446
Entry
66446             CDS       T01002                                 
Symbol
Exosc7, 2610002K22Rik, mKIAA0116
Name
(RefSeq) exosome component 7
  KO
K12589  exosome complex component RRP42
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    66446 (Exosc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    66446 (Exosc7)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     66446 (Exosc7)
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     66446 (Exosc7)
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 66446
NCBI-ProteinID: NP_001074657
MGI: 1913696
Ensembl: ENSMUSG00000025785
UniProt: Q9D0M0
Position
9:122942296..122965194
AA seq 291 aa
MASVALSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILV
GVKAEMGTPKLEKPNEGYLEFFVDCSANATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
LRSLCISPREHCWVLYVDVLLLECGGNLFDAISIAVKAALFNTRIPRVRVLEDEEGAKDI
ELSDDPYDCIRLSVENVPCIVTLCKIGCRHVVDATLQEEACSLASLLVSVTSKGVVTCMR
KVGKGSLDPESIFEMMESSKRVGKVLHVSLQSLLHKEESLGPKRPRVGFLG
NT seq 876 nt   +upstreamnt  +downstreamnt
atggcgtcggtggcgctaagcgaggccgagaaggtctacatcgttcatggagtgcaggaa
gaccttcgggtggatggccgtggctgtgaggactaccgatgtgttgaagtagagactgat
gtggtgtctaacaccagtgggtctgccagagtcaagctgggtcacacagacatcttggtg
ggagtgaaagcagaaatggggacaccgaagctggagaaaccgaatgaaggctacctggag
ttctttgttgactgttcagccaatgctaccccagaattcgaagggcgaggaggtgatgac
cttggcacagagattgctaacaccctctaccggatatttaacaacaagagcagcgtagac
ctgaggtccctctgcatcagtcctcgagagcactgctgggttctatatgtggatgtgctg
ctgctggaatgtggtgggaatttgtttgatgctatttccattgctgtaaaagctgctctc
ttcaacacaaggataccaagggttcgtgttctggaggatgaagagggggcaaaggacatt
gagctgtctgacgatccttatgactgcatccgactgagtgtagagaatgtcccctgcatt
gtcaccctgtgcaagattggctgccggcatgtggtagatgccacacttcaagaggaggcc
tgttccctggccagcttgctggtgtcagtgaccagcaagggagtagtgacatgcatgagg
aaagtggggaaaggaagcctggatcctgagagcatcttcgagatgatggagagcagcaag
cgagtgggcaaggtgctgcacgtgtccttgcagagccttctgcacaaggaagaaagcctg
gggcccaagaggccgagagtcgggttcctggggtga

DBGET integrated database retrieval system