KEGG   Mus musculus (house mouse): 66449
Entry
66449             CDS       T01002                                 
Symbol
Pam16, 2010110I09Rik, AV006767, CGI-136, Magmas, Tim16, Timm16
Name
(RefSeq) presequence translocase-asssociated motor 16
  KO
K17805  mitochondrial import inner membrane translocase subunit TIM16
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    66449 (Pam16)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    66449 (Pam16)
SSDB
Motif
Pfam: Pam16 SLAIN
Other DBs
NCBI-GeneID: 66449
NCBI-ProteinID: NP_079847
MGI: 1913699
Ensembl: ENSMUSG00000014301
UniProt: Q9CQV1
Position
16:complement(4434330..4442810)
AA seq 125 aa
MAKYLAQIIVMGVQVVGRAFARALRQEFAASQAAADARGRAGHQSAAASNLSGLSLQEAQ
QILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQAQEDREKG
QKPKT
NT seq 378 nt   +upstreamnt  +downstreamnt
atggccaagtacctggcccagatcattgtgatgggtgtgcaggtggtgggcagagccttt
gccagggccctgaggcaggagtttgcagccagccaggcagccgctgacgctcgagggcgt
gctgggcaccagtctgcagctgcatccaatctctctggcctcagcctccaggaagcccag
cagattctcaacgtctccaagctgagccccgaggaggtccagaagaattatgaacaccta
tttaaagtgaatgataagtccgtgggtggctctttctacctgcagtcaaaggttgtccgt
gcaaaggaacgtctagatgaggaactccgaatacaagcccaggaagacagagagaaaggg
cagaagcccaaaacgtga

DBGET integrated database retrieval system