KEGG   Mus musculus (mouse): 66459
Entry
66459             CDS       T01002                                 

Symbol
Pyurf, 2610022G08Rik, AI847956, Pi, Prey
Name
(RefSeq) Pigy upstream reading frame
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Trm112p
Other DBs
NCBI-GeneID: 66459
NCBI-ProteinID: NP_079850
MGI: 1913709
Ensembl: ENSMUSG00000043162
Vega: OTTMUSG00000024212
UniProt: Q9D1C3
Position
6; 6 B3
AA seq 112 aa
MLSATCRRLAPALRRLRALSAVAGRFLQVPGARLCSDQSERAEQPHTFHPALLQFLVCPL
SKKPLRYEASTNELVNEELGIAYPIIDGIPNMIPQAARTTRQNEKQEEAEQP
NT seq 339 nt   +upstreamnt  +downstreamnt
atgctgagcgccacgtgccgcaggctcgccccggcgctgcggaggctccgcgcactgtct
gcagtcgccgggaggtttctgcaagtgcccggggccaggctctgctctgaccagagcgag
agggctgagcagccccacaccttccacccggcgctgctgcagttcctggtgtgtccgctc
tccaagaagccgcttagatatgaagcatcgacaaatgaattggttaatgaagagttggga
atagcatatccaatcattgatgggatccctaatatgataccacaggcagcaaggaccaca
cgtcaaaatgagaagcaagaagaagctgagcaaccctag

DBGET integrated database retrieval system