KEGG   Mus musculus (house mouse): 66461
Entry
66461             CDS       T01002                                 
Symbol
Ptpmt1, 1110001D10Rik, 2810004N20Rik, PLIP
Name
(RefSeq) protein tyrosine phosphatase, mitochondrial 1
  KO
K14165  atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    66461 (Ptpmt1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     66461 (Ptpmt1)
    3.1.3.48  protein-tyrosine-phosphatase
     66461 (Ptpmt1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    66461 (Ptpmt1)
SSDB
Motif
Pfam: DSPc DSPn Y_phosphatase Y_phosphatase2
Other DBs
NCBI-GeneID: 66461
NCBI-ProteinID: NP_079852
MGI: 1913711
UniProt: Q66GT5 Q3U926
Structure
Position
2:complement(90741057..90748395)
AA seq 261 aa
MAPVPGSLGQGRDSGDSASKSREASGGPQLSSSASFSRWLVASPGAGGWPLRLAGWGASP
LRLAGWGGMAASAWLEAGLARVLFYPTLLYTVFRGRVRGPAHRDWYHRIDHTVLLGALPL
KNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLH
KGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIR
PSQLEVLKEFHKEITARAAKN
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctcctgttccgggatccctcgggcagggccgggactccggggactcagcttcgaag
agtcgggaggcatcaggtggccctcagctctcgtcctccgcgtccttctcgcggtggctg
gtcgcgagccccggggccggtggctggccgctgcgcctggcggggtggggcgcctcgcca
ctgcgcctggcggggtggggcgggatggcggcctccgcgtggctggaggccggcctggcc
cgggtgctcttctacccgacgctgctctacacagtgttccgggggagggtgcgcggcccg
gcgcaccgcgactggtaccaccgcatcgaccacacggttctgctgggcgcgctgccgctg
aagaacatgacgcgccggctggtactggacgagaacgtgcgcggggtgatcactatgaac
gaggagtacgagacccgattcctgtgcaacacctcgaaggaatggaagaaagcaggagtt
gagcagctacggctcagcacagtcgacatgactggggtcccaaccttggccaatctccac
aaaggagtccagtttgctctcaagtaccaggcactgggccagtgtgtctatgtgcattgt
aaggctggtcgatccagaagtgccacaatggtggcagcctatctgattcaggtacacaac
tggagcccagaggaggctatagaagcgatcgccaaaatccggtcacacatctccatcagg
cccagccagctggaagttctcaaagagttccacaaggagatcactgcaagggcagcaaag
aattaa

DBGET integrated database retrieval system