KEGG   Mus musculus (mouse): 66469
Entry
66469             CDS       T01002                                 

Symbol
Prxl2b, 2810405K02Rik, AI836168, Fam213b, PM/PGFS
Name
(RefSeq) peroxiredoxin like 2B
  KO
K15717  prostamide/prostaglandin F2alpha synthase [EC:1.11.1.20]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    66469 (Prxl2b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.20  prostamide/prostaglandin F2alpha synthase
     66469 (Prxl2b)
SSDB
Motif
Pfam: AhpC-TSA_2 AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 66469
NCBI-ProteinID: NP_079858
MGI: 1913719
Ensembl: ENSMUSG00000029059
Vega: OTTMUSG00000010466
UniProt: Q9DB60
Position
4; 4 E2
AA seq 201 aa
MNVVDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRSI
LDQHDVRLVGVGPEALGLQEFLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGK
PVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFIQKSPGDYVPQENILQAL
GISAEVCSSKPPQCDEEVCGR
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaatgtggtggaccttggtcgcgtaggagcgtgtgtcttgaaacatgcagtgactggg
gaggctgtggagctgcggagcctatggcaggagaaagcttgtgtggtggccggtctgcga
cgcttcggctgcatggtgtgccgctggatcgcccaggacctcagcaacctccggagcatc
ctggaccaacacgatgtgcgcctggtgggcgtggggcctgaggccctgggcctgcaggag
tttctggatggtggttacttctcaggagaactctaccttgatgagagcaagcaaatctat
aaggagctgggcttcaagcggtacaacagcttaagcatcctaccagctgccctgggaaaa
cctgttcgtgatgtagcctccaaggctaaagctgttggtatccaggggaacctgtctggt
gacctgctgcaaagtggagggctgctggtggtcagcaagggtggcgacaaggtactgttg
cacttcatccagaagtccccgggtgactatgttccccaggagaacatcctgcaggccttg
ggtatctctgcagaggtttgctccagcaagccaccccagtgtgatgaagaggtgtgtggg
aggtga

DBGET integrated database retrieval system