KEGG   Mus musculus (mouse): 664799
Entry
664799            CDS       T01002                                 

Gene name
Ctcfl, Boris
Definition
(RefSeq) CCCTC-binding factor (zinc finger protein)-like
  KO
K23195  transcriptional repressor CTCF
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    664799 (Ctcfl)
   03036 Chromosome and associated proteins [BR:mmu03036]
    664799 (Ctcfl)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    664799 (Ctcfl)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    664799 (Ctcfl)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_7 RNA_polI_A34
Other DBs
NCBI-GeneID: 664799
NCBI-ProteinID: NP_001074856
MGI: 3652571
Ensembl: ENSMUSG00000070495
Vega: OTTMUSG00000016680
UniProt: A2APF3
Position
2; 2 H3
AA seq 636 aa
MAAAEVPVPSGYFTQIKEQKLKPGDLEEEKEEDGVQRVEAQEGVVKEVEAENSCLLLEAR
APVESDRRILTLQTVHLESQDVHLQGLGWLSVPHSEELSGTVPEAEGILQLPSVLWLDPE
PQLSLQHCVTVSIPEELYPPEELQRIHFHLLRENVLMAEENPELTPDLDESTALKKPEED
EKDQLPPQGETDKREERLLLLEMKPKEGKDDEIVLTISHLSLEEQQDPPAANQTSVPGAK
AAKPKRRRQTKGKPQSFQCDTCPFTSSKLSTFNRHIKIHSNERPHLCHLCLKAFRTVTLL
RNHVNTHTGTRPHKCRDCDMAFVTSGELVRHRRYKHTYEKPFKCSLCKYASVEASKMKRH
IRSHTGERPFQCCQCAYASRDSYKLKRHMRTHSGEKPYECPTCHVRFTQSGTMKIHIAQK
HGENVPKYECPHCATIIARKSDLRVHLRNLHSQSPEEMKCRYCPAGFHERYALIQHQRTH
KNEKKFKCKQCDYACKQERCLKAHMRMHTGEKPFSCLACNKHFRQKQLLTVHLRKYHDPN
FVPNLHLCLKCDKRFSRWSNLQRHRKKCDPEHETLAPNKDRRPVTRTQASEGEAGHKEGE
PQCPGEQALGHQGEAAGSQSPDHGLTCEIIFNMMDK
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggctgccgctgaggtccctgtcccttctgggtacttcacccagatcaaagagcagaag
ttgaagcctggagacctagaggaggagaaagaggaggacggggtacaaagagtggaagcc
caggagggagttgtcaaggaggtggaggccgagaacagttgcctgcttctggaggccagg
gccccggtggagagcgacaggcggatcctgaccctgcaaacggtgcacctggagtcccag
gatgtgcacctacaggggctgggatggctgagcgtgccacactctgaggagctttcaggg
acggtaccagaggcggaaggcatactgcagttgccatccgtgctgtggctcgacccagag
ccccagctcagccttcagcattgcgtgacggtcagcatcccggaagagctgtacccacca
gaggagctgcagcggatacattttcacctgctgagagagaatgtgctaatggccgaggag
aacccagagttaacaccagacttggacgaaagcacagccctgaaaaagcccgaagaagat
gaaaaggaccagctcccgccccagggagagacagacaagagagaagagaggttgctcctt
ctggaaatgaaaccaaaagagggaaaagacgacgaaattgtcctgaccatttcccatcta
agcctcgaagaacagcaagatccaccagcggccaatcagacaagtgtgccgggagccaaa
gccgcaaaaccaaaacggcggaggcagaccaagggaaagcctcagagctttcagtgtgac
acctgcccgttcacttcctccaagctctcaactttcaatcgtcacatcaaaattcacagc
aatgagaggccacacctgtgtcacctgtgcctgaaggccttccggactgtcactcttctt
aggaaccatgtgaacacccacacaggaaccaggccccacaagtgcagggactgcgacatg
gcgtttgtcaccagtggagaactcgtccggcacaggcgttacaaacacacttatgagaag
cccttcaagtgctccctgtgcaagtacgccagcgtcgaggcaagcaagatgaagcgtcac
atccgctcacacacgggtgagcgtcccttccagtgttgccagtgtgcttacgccagcagg
gactcctacaagctgaagcgccacatgaggacacactcaggtgagaagccgtatgaatgt
cccacctgtcacgtccggttcacccagagcgggaccatgaaaatccatatagcacagaag
cacggagagaatgtgcccaaatacgagtgtccccactgtgccaccatcatcgcgaggaag
agcgacctgcgtgtccatctgcgtaacctgcacagccagagcccggaggagatgaagtgc
cgatactgtcccgctggcttccatgagcgctatgccctcattcagcaccagaggacccac
aagaacgagaagaagttcaagtgcaagcagtgcgattacgcgtgcaagcaggagcgatgc
ttgaaggcgcacatgcgcatgcacacaggagagaagcccttctcctgcctggcctgcaac
aagcacttccgacagaagcagctactgaccgtgcacctgaggaagtaccatgacccgaac
ttcgtccccaatctgcacctgtgcctcaagtgtgataaacgtttctcccgctggagtaac
ctgcagagacacagaaagaagtgtgacccggagcatgagacgttagcccccaacaaggac
aggagaccagtgacaaggacacaggcctcggagggagaagcaggacacaaggaaggggag
cctcagtgccctggggagcaggctctgggccaccaaggagaagcagcggggagccagagc
ccagaccacggccttacctgcgagataatctttaacatgatggataagtga

DBGET integrated database retrieval system