KEGG   Mus musculus (mouse): 66487
Entry
66487             CDS       T01002                                 

Symbol
Smim4, 2010107H07Rik, Gm41122
Name
(RefSeq) small integral membrane protein 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UPF0640
Other DBs
NCBI-GeneID: 66487
NCBI-ProteinID: NP_001295020
MGI: 1913737
Ensembl: ENSMUSG00000058351
Vega: OTTMUSG00000057521
UniProt: Q8C1Q6
Position
14; 14 B
AA seq 80 aa
MFSRAQVRRALQRVPGKQRFGIYRFLPFFFVLGGAMEWIMIKVRVGQETFYDVYRRKASE
RQYQRRLEDTSETNLHKLIK
NT seq 243 nt   +upstreamnt  +downstreamnt
atgttctccagggcccaggtgaggcgagctcttcagcgagtgcccggcaagcagcgattc
ggcatctacagattcctgcccttcttttttgtcctgggaggtgcgatggagtggatcatg
attaaagtgcgcgtgggccaggagaccttctatgatgtctaccgtagaaaagcttcagaa
agacagtatcagagaaggctggaagatacatcagaaaccaatcttcataagctaataaag
taa

DBGET integrated database retrieval system