KEGG   Mus musculus (house mouse): 66488
Entry
66488             CDS       T01002                                 
Symbol
Fam136a, 2010309E21Rik, AW124904, Hyccin
Name
(RefSeq) family with sequence similarity 136, member A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF842 Nuf2_DHR10-like zf-C2H2_8 DUF411 DUF4754 DUF1048
Other DBs
NCBI-GeneID: 66488
NCBI-ProteinID: NP_079867
MGI: 1913738
Ensembl: ENSMUSG00000057497
UniProt: Q9CR98
Position
6:86342453..86347040
AA seq 138 aa
MAEVQQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAP
LAQAQALVTSELERFQDRLARCTMHCNDKAKDSMDAGTKELQVKRQLDSCVTKCVDDHMH
LIPTMTKKMKESLSSIGK
NT seq 417 nt   +upstreamnt  +downstreamnt
atggcggaggtgcagcaactccgagtgcaggaggctgtggacgccatggtgaaaagtgtg
gagagagagaacatccggaagatgcagggcctcatgttccggtgcagcgccaactgctgt
gaagacacccaagcatctatgcagcaggtgcaccaatgcatcgagcgctgccatgcgcct
ctggctcaagcccaggctctggtcaccagcgagctggaaaggttccaggaccgcctggcc
cgctgcaccatgcattgcaatgacaaagccaaagactcaatggatgcaggaactaaggag
cttcaggtgaagcgacagctagacagctgtgtgaccaagtgtgtggatgaccacatgcac
ctcatcccaacaatgaccaagaagatgaaggagtctctgtcatccatagggaaataa

DBGET integrated database retrieval system