KEGG   Mus musculus (house mouse): 66492
Entry
66492             CDS       T01002                                 
Symbol
Zmat2, 2610510D14Rik, 2900082I05Rik
Name
(RefSeq) zinc finger, matrin type 2
  KO
K12848  U4/U6.U5 tri-snRNP component SNU23
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    66492 (Zmat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    66492 (Zmat2)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    66492 (Zmat2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    66492 (Zmat2)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met zf-U1 SNRNP27 Cgr1 DUF6277 DUF4250 Tra1_central zf-C2H2
Other DBs
NCBI-GeneID: 66492
NCBI-ProteinID: NP_079870
MGI: 1913742
Ensembl: ENSMUSG00000001383
UniProt: Q9CPW7
Position
18:36926976..36932713
AA seq 199 aa
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgtctggcagcgggacaaaaaacttggactttcgccgaaagtgggacaaagatgaa
tatgagaagctcgcggagaagagactcacagaggagagagagaagaaggatgggaaacca
gtgcagcctgtcaagcgggagcttctgcggcacagggattacaaggtggacctggagtcc
aagctggggaagacgattgttatcaccaagacgaccccacagtctgaaatgggaggctac
tactgcaatgtctgtgactgtgtggtgaaagactccattaacttcctggaccacattaat
ggaaagaaacatcagcgaaacctgggtatgtccatgcgcgtggaacgctccactctggat
caggtaaagaagcgttttgaggtgaacaagaagaagatggaagagaagcagaaagattat
gattttgaggaaaggatgaaggagctcagagaagaggaggaaaaggctaaagcatacaaa
aaagagaaacagaaggagaagaaaaggagagccgaggaggacttgacttttgaggaggat
gatgaaatggcagctgtgatgggtttctctggctttggttccaccaagaagagttactga

DBGET integrated database retrieval system