KEGG   Mus musculus (mouse): 66493
Entry
66493             CDS       T01002                                 

Gene name
Mrpl51, 2610511M02Rik, CDA0, CDA09, HSPC2, HSPC241, Mrp, Mrp64
Definition
(RefSeq) mitochondrial ribosomal protein L51
  KO
K17432  large subunit ribosomal protein L51
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    66493 (Mrpl51)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    66493 (Mrpl51)
SSDB
Motif
Pfam: MRP-L51
Other DBs
NCBI-GeneID: 66493
NCBI-ProteinID: NP_079871
MGI: 1913743
Ensembl: ENSMUSG00000030335
Vega: OTTMUSG00000024231
UniProt: Q9CPY1
Position
6; 6 F3
AA seq 128 aa
MAGSVPWAASRRLWGWVPSACRSFSLGVPRLAFVRLTLPPPKVVDRWNEKRALFGVYDNI
GILGNFEKHPKELIKGPVWLRGWRGNELQRCVRKKKFVGNRMFIEDLHNLNKRISYLYKH
FNRHGKYR
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcagggagtgtcccttgggcggcaagtaggagactgtggggctgggtgccctcggca
tgccgaagcttctctctgggcgtcccacggttggccttcgtaaggctcactcttccacct
cccaaagtggttgatcgctggaacgagaagagggctctgtttggcgtctacgacaacatt
ggaatcctggggaatttcgagaagcacccaaaagaactgatcaagggcccagtatggctt
cgaggctggagaggaaatgaattgcagcgttgtgtccgaaagaagaaatttgtgggaaac
aggatgttcattgaggacctgcataaccttaacaaacggatcagctatctctacaaacac
tttaaccgacatgggaagtacagatag

DBGET integrated database retrieval system