KEGG   Mus musculus (mouse): 665033
Entry
665033            CDS       T01002                                 

Gene name
Col6a5, Col, Col29a1, EG665033, Gm7455
Definition
(RefSeq) collagen, type VI, alpha 5
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    665033 (Col6a5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    665033 (Col6a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    665033 (Col6a5)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    665033 (Col6a5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    665033 (Col6a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    665033 (Col6a5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    665033 (Col6a5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   665033 (Col6a5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   665033 (Col6a5)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   665033 (Col6a5)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Radical_SAM VWA_CoxE Copine
Other DBs
NCBI-GeneID: 665033
NCBI-ProteinID: NP_001161395
MGI: 3648134
Ensembl: ENSMUSG00000091345
Vega: OTTMUSG00000049419
UniProt: A6H584 A0A140T8W1
Position
9 F1; 9
AA seq 2640 aa
MKLRLIAFVLILWTETLADQSPGPGPEYADVVFLVDSSNYLGIKSFPFVRTFLNRMISSL
PIEANKYRVALAQYSDALHNEFQLGTFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRT
YFSAPTNGRDKKQFPPILVVLASAESEDDVEEAAKALREDGVKIISVGVQKASEENLKAM
ATSQFHFNLRTARDLGMFAPNMTRIIKDVTQYREGTTVDLITAVAPTTPAAPATPAAPTI
PAALTTAANHVDKTVPFPTSCQKDSLADLIFLVDESVGTTQNLRDLQNFLENVTSSVDVK
DNCMRLGLMSFSDRAQTISSLRSSANQSEFQQQIQKLSLQTGASNVGAAIEQMRKEGFSE
SSGSRKAQGVPQIAVLVTHRASDDMVREAALDLRLEGVTMFAMGIEGANNTQLEDIVSYP
SRQSISTHSSYSHLESYSGNFLKKIRNEIWTQVSTRAEQMELDKTGCVDTKEADIYFLID
GSSSIRKKEFEQIQIFMSSVIDMFPIGPNKVRVGVVQYSHKNEVEFPVSRYTDGIDLKKA
VFNIKQLKGLTFTGKALDFILPLIKKGKTERTDRAPCYLIVLTDGKSNDSVLEPANRLRA
EQITIHAIGIGEANKTQLRQIAGKDERVNFGQNFDSLKSIKNEIVHRICSEKGCEDMKAD
IMFLVDSSGSIGPTNFETMKTFMKNLVGKIQIGADRSQVGVVQFSDYNREEFQLNKYSTH
EEIYAAIDRMSPINRNTLTGGALTFVNEYFDLSKGGRPQVRKFLILLTDGKAQDEVGGPA
TALRSKSVTIFSVGVYGANRAQLEEISGDGSLVFHVENFDHLKAIESKLIFRVCALHDCK
RIELLDIVFVLDHSGSIGPREQESMMNLTIHLVKKADVGRDRVQIGALTYSNHPEILFYL
NTYSSGSAIAEHLRRPRDTGGETYTAKALQHSNVLFTEEHGSRLTQNVRQLMIVITDGVS
HDRDKLDEAARELRDKGITIFAVGVGNANQDELETMAGKKENTVHVDNFDKLRDIYLPLQ
ETLCNNSQETCNLPEADVIFLCDGSDMVSDSEFVTMTTFLSDLIDNFDIESQRMKIGMAQ
YGSRYQEIIELESSLNKTQWKSQVHSVAQSKGLPRLDFALKHVSDMFDPSVGGRRNAGVP
QTLVVITSSSPRYDVTDAVKVLKDLGICVLALGIGDVYKEQLLPITGNSEKIITFRDFNK
LKNVDVKKRMVREICQSCGKANCFVDVVVGFDISTHRQGQPLFQGHPRLESYLPGILEDI
TSIRGVSCGAGAEAQVSLAFKVNSDQEFPAKFQIYQKAAFDSLLHVTVRGPTHLDAPFLQ
SLWDMFEERSASRGQVLLIFSDGLQGESITLLERQSDRLREAGLDALLVVSLNTFGHDEF
SSFEFGKGFDYRTQLTIGMLDLGKTLSQYLGNIAERACCCTFCKCPGIPGPHGTRGLQAS
KGSSGPKGSRGHRGEDGDPGRRGEIGLQGDRGVVGCPGTRGQKGVKGFSGAQGEHGEDGL
DGLDGEEGFYGFRGGKGQKGDPGNQGYPGIRGAAGEDGEKGFPGDPGDPGKDSNIKGQKG
EKGERGRQGITGQKGTHGRPSSKGSRGMEGQRGPQGPSGQAGNPGPQGTQGPEGLQGSQG
SSGNRGGKGDKGSQGYQGPQGSPGPAGPRGDIGRPGFGGRKGEPGVPGGPGPVGPPGQRG
KQGDYGIPGYGQTGRKGVKGPTGFPGDPGQKGDAGNPGIPGGPGPKGFKGLTLSQGLKGR
SGLQGSQGPPGRRGPKGTAGQPIYSPCELIQFLRDHSPCWKDKCPVYPTELVFALDQSSG
ITERRFNETRDTITSIVSDLNIRENNCPVGARVAVVSYDSDTSYLIRGSDYHNKKHLLQL
LSQIKYQVPRKARDIGNAMRFVARNVFKRMSAGTNTRRVAVFFSNGQAASRASILTATME
LSALDISLAVFAYNERVFLDEAFGFDDTGTFQVIPVPPVGDYEPLEKLRRCTLCYDKCFP
NTCAEEPFFPENSYMDVAFLLDNSKNIASDDFQAVKALVSSVIDSFHITSNPSASESGDR
VALLSYSPSESSRRKGRVKTEFAFTTYDNQSIMKNYIYTSLQQLNGDATIGLALQWAMEG
LFLGTPNPRKHKVIIVISAGENHEEKEFVKTVALRAKCQGYVVFVISLGSTQRDEMEELA
SYPLDHHLIQLGRMYKPDLNYIVKFLKPFIYSVRRGFNQYPPPTLKDDCRLVELERGDTL
PHGLRLTAKLREVPESTISLADQELNAGKDSSFVLEDHRGDHLVYVPSQMLEPHKLVSHY
GNDRESVAMASLTSEHESHGREELGLAHEPGDASLQEYYMDVAFLIDASQRVGGRNEFKE
VRTLITSVLDYFHIAPAPLTSVLGDRVAVLTYSPPGYLPNTEECPVYLEFDLVTYNTVHQ
MKHHLQESLQQLNGDVFIGHALQWTVDNVFVGTPNLRKNKVIFIVTAGETNPLDKEVLRN
ASLRAKCQGYSIFVFSFGPIHNDMELEELASHPLDHHLVRLGRVHRPDLDYVIKFIKPFV
HSIRRAINKYPGRDLQAKCDNLTFPGPENAGTEDSALLIPEVYRIEAGENELSGDSGSQE
QHFFLLGNSHGNHSESTADLMRQLYLLLSSGELMVNDKEEPCSAETPAPVNSKQDGEDAR
NT seq 7923 nt   +upstreamnt  +downstreamnt
atgaagctccggctaattgcgtttgtcttaatcctctggactgaaaccctggcagaccag
agcccagggccaggccccgagtacgcagacgtggtgtttctggtggacagctccaattac
ctgggaattaagtccttcccatttgtgagaacttttctcaacaggatgatcagcagcctc
cccatagaggccaacaagtaccgcgtggccctggcccagtacagcgatgctctccacaat
gagttccagctgggcaccttcaagaacaggaaccccatgctgaaccacctgaagaagaac
ttcgggttcatcggtggctccctgaagatagggaacgccctgcaggaggctcacaggacc
tatttctctgctcccacaaatgggagagacaagaaacagttccccccaatcctggtggtg
ctggcttcagcagagtctgaggatgatgtggaagaggctgcgaaggccctgcgggaagat
ggggtgaaaatcatctctgtgggggtgcagaaggcttctgaggaaaacctgaaggcgatg
gccacctctcagttccatttcaatctcaggactgccagagacctcggcatgtttgcccca
aacatgacacggatcatcaaggatgtgactcagtacagggaagggacaactgtggactta
atcacagctgtagccccaaccacacctgcagccccagccacacctgcagccccaaccata
cctgcagctctaaccacagctgccaaccacgttgataagacagttccctttcccacctct
tgccagaaggactcccttgccgaccttatattcttggtggatgagtcagtggggaccaca
cagaatctgagggacctgcagaacttcctggagaatgtcaccagctctgtggatgtgaag
gacaactgcatgcggcttgggctgatgagcttcagcgacagggctcagactatttcttcc
ctgaggtcaagcgccaaccagtctgaattccagcagcaaatccagaaactctctctccag
actggggcatctaatgttggggccgccattgagcagatgaggaaagaaggcttctcagag
tccagtggcagcaggaaggcccagggcgtcccccagattgctgtgctggtcacccacaga
gcatcagatgacatggtgcgggaggctgcactggatctgcgcttggagggtgtaactatg
tttgcaatgggcatcgaaggggccaacaacacgcaattagaagacatagtgtcataccct
tccaggcagagcatttccacacacagctcctacagtcacttggaatcatacagtgggaac
ttcctgaagaagatccgcaatgaaatctggacccaagtttctactcgtgctgaacaaatg
gagctggataaaaccggctgtgtggatacaaaggaggccgacatctattttctcattgat
gggtcgtccagcatccgtaagaaagagtttgagcaaatccagatatttatgtcatctgtg
atagacatgtttcctatcggccccaacaaagttcgggtcggagttgtgcagtattcacat
aagaatgaagtggaatttcctgtctctcgctacacggatggcattgacttgaaaaaggct
gtttttaacatcaagcaactcaaaggtcttacattcaccgggaaagccctggatttcata
ttgcctctcataaagaagggaaaaacagagaggaccgacagagccccctgttacctcatc
gtgctgactgatggaaagtcaaatgacagcgttctcgaacctgccaacagactgcgggct
gagcagatcaccattcacgccatcgggattggcgaggcaaacaaaacacagctgcggcag
attgctgggaaggacgaaagggttaacttcgggcagaacttcgattctctgaagagcata
aaaaatgaaatcgttcaccgcatctgctctgaaaaaggatgtgaagacatgaaggcagac
atcatgtttttggtggacagttctggaagcatagggcctacaaattttgagacaatgaaa
actttcatgaaaaatctggtggggaagattcagattggcgccgacagatcccaagtcggt
gttgttcaattcagtgactataacagggaagaattccagcttaataaatactccacgcat
gaggaaatttatgcagccatagataggatgtctcccatcaacagaaacactctgacagga
ggagcactaacctttgtaaatgaatactttgacctttccaagggggggcgcccccaggtc
agaaagttccttatcctcctcacagatggaaaagctcaggacgaagtggggggcccagcc
acggctctcaggagcaaaagtgtgaccatcttctccgtgggtgtgtatggggccaatagg
gctcagctggaggagatcagtggagatggcagtctggttttccatgttgagaactttgac
catctgaaggccatagagagtaaactcatctttcgagtgtgtgctctgcatgattgcaag
aggatcgaactcttagacatcgtgtttgtgctggaccactcaggcagcataggtccacgt
gagcaagaaagcatgatgaacctcaccatccacttggtgaagaaggcagacgttggtagg
gaccgagtgcagattggagcgctcacatactccaaccatcccgagatcctcttctatctt
aacacttactcaagtggatcagccattgctgagcatctgaggaggcccagggacaccgga
ggggagacctacactgccaaggctcttcagcattccaacgtcctgttcacagaagagcat
ggcagccgcctgacgcagaacgtgaggcagctgatgattgtcatcacggatggcgtgtcc
cacgaccgagataaactcgacgaggcagcacgggaactcagagacaaaggcatcaccatc
tttgcagtgggtgtaggaaatgccaaccaagatgaactggagaccatggcagggaagaaa
gaaaacactgtccatgtagacaactttgacaaactgagagatatttacctgcctctgcaa
gagactctgtgtaataattcacaagagacttgtaaccttccggaagctgatgtgattttc
ctttgtgatggctctgacatggtgtctgattcagagttcgttaccatgacaactttcttg
tcagacttaattgataattttgacattgagtctcaaagaatgaagattgggatggctcaa
tacgggagccggtatcaggaaattattgagttggaaagctctctgaacaagactcagtgg
aagtctcaggtccacagtgtggcccagagcaaggggttgccacgccttgactttgctctc
aagcatgtgagtgacatgtttgatccatccgttggcgggagaaggaacgctggtgtccct
cagactctggttgttataacatctagttctccacgctatgatgtgacagacgcggtaaag
gtcctgaaagaccttggcatctgtgtcctggctttgggcataggggatgtttataaggaa
cagcttctgcccatcacaggcaattcagaaaagataattactttccgagactttaataag
ctaaagaatgtggatgtgaagaagagaatggttcgtgaaatttgccagagctgtgggaaa
gccaattgctttgtggatgtagtggtcgggttcgacatttccactcaccgtcagggccag
cctttgttccagggccatccccgcttagaatcctacctcccgggcatcttggaggacatc
acctctatcagaggggtgagctgtggtgcaggtgcagaggcgcaggtgagcctggccttt
aaggtgaacagtgaccaagagttcccagccaagttccagatctatcagaaagcagcgttt
gacagcttgttgcacgtcacagtccgtggaccaactcatctggatgcaccgttcttgcag
tcactttgggacatgtttgaggaaagatctgcatccaggggccaggttctgctcatcttc
tcagacggtctccagggtgaaagcatcaccttgctggagcggcagtcagacaggctcaga
gaagcaggacttgatgctctgttggtggtgtcccttaacacattcggtcacgatgagttt
tccagctttgaatttggaaaaggatttgactacaggactcagctgaccattgggatgcta
gacctgggcaagacgctctcacagtacctgggaaacatcgcagaaagggcttgctgctgt
acattttgtaaatgtccggggattccaggacctcatggaacccggggactccaagcctca
aagggttcttcaggtccaaaaggtagcagaggacacaggggagaggacggagaccctgga
agacgaggagaaattgggcttcaaggagacagaggagtcgtgggatgcccggggactcga
ggtcaaaagggagtcaaaggattttcaggagctcagggggaacatggagaggacgggctg
gacggactggatggagaagaaggattttacggatttcgtgggggaaagggacaaaaaggt
gaccctggcaatcagggttacccaggcatcagaggcgctgctggggaagatggcgagaag
ggcttcccaggggatcccggtgacccaggaaaagacagcaacatcaaaggccagaagggc
gagaaaggagaacgaggaagacaagggataactgggcagaaggggacacatggccgtcct
agctccaaaggaagcaggggaatggagggccagagggggccccagggtccctcagggcag
gcaggaaacccaggacctcaaggtacacaaggacctgaaggactacaaggctcacaggga
tcaagtggaaatcgtggagggaaaggagacaaaggaagtcaaggttatcagggacctcag
ggttctcctgggccagcaggacccagaggggatattggaagacctggatttggggggaga
aagggggaacctggagttcctggaggcccaggaccagtggggccccctggacagcgagga
aagcagggagattatggcatcccgggctatggtcagacaggaagaaaaggagttaagggc
ccaacaggattccctggggacccagggcagaagggtgacgctggcaatcctggaattcct
gggggacctggacccaaaggattcaagggactgactctctctcaaggcttgaaaggcagg
agtggacttcaggggtctcaaggccctcctggtcggagaggtcctaaaggcacagcaggg
caacctatatattccccctgtgaactgatccagttcctgagggaccacagcccctgttgg
aaagacaagtgccctgtgtatccaacagagctggtctttgctctggaccagtcctctggt
atcacagaaaggagatttaatgaaacaagggacaccatcacttcaattgtcagtgacctc
aacatcagggagaacaactgtcccgtgggagcacgggttgccgtggtctcctatgactca
gacaccagctatctcatccgtggctctgactaccataacaagaagcatctcctacagctt
ctttcccagataaaataccaagtgccccggaaggccagggacattggcaatgcaatgagg
tttgtggcccgcaacgttttcaagcggatgtctgcgggaaccaacaccaggagagtggct
gtgtttttcagcaatggccaggcagccagtagagcatccatcctcacggccaccatggag
ttgagtgccctcgatatcagccttgccgtctttgcttataacgaaagagtgttccttgat
gaggcttttgggtttgatgacactgggacatttcaggtgattccagtccccccagttgga
gattatgagccactggagaagcttcggcgctgcacactttgctatgacaagtgttttcca
aacacctgtgcagaagagcctttctttcctgagaattcctacatggatgttgcattcctc
ttagacaattccaaaaacatcgccagcgatgacttccaagccgtgaaagcgctggtgagc
tcagtgattgacagcttccacatcacttcaaacccttcagcctcagagtctggtgacagg
gttgctttgctgagctattctccctcagagagctccagaaggaagggcagggtgaagaca
gagtttgcctttacaacctacgacaaccaatcaatcatgaagaactacatctacacttcc
cttcaacagctcaatggagatgctactattggccttgccctacagtgggccatggaaggt
ctcttcctgggaacccccaatccaagaaaacacaaggtcatcattgtgatttcagctgga
gaaaaccatgaggagaaggaatttgtgaagacggtggctttgagggccaaatgtcaaggc
tatgtcgtatttgtgatatctctgggctccacacaaagagatgagatggaagaattagcc
agctacccactcgatcaccatctgatacagcttgggagaatgtacaagccagatctgaat
tatattgtgaaatttctgaagccctttatatactcggtcagacgcggatttaatcaatac
ccaccacccacgctgaaggacgactgcagacttgttgagttagagaggggagacacactg
ccccatggcctcagattgactgctaagctgcgtgaggttcctgagagcacaatcagcctg
gctgatcaagagctgaacgctgggaaagactcatcttttgtgttggaggatcacagaggc
gaccatttggtttacgttccaagccagatgctagagccacataagttagtgagccactat
ggaaatgaccgggaatctgtagcaatggcgagtctcacttctgaacatgaaagtcatggc
agagaagaactgggtcttgctcatgagcctggggatgcttctcttcaagaatattacatg
gacgtggctttcctcatagatgcttctcaacgagtaggaggacgtaacgagtttaaggaa
gtgagaactttgataacgtcagtactggattactttcacattgccccagctccactgacc
tctgtcttaggagacagagtggctgtcctgacctactctcccccaggctatctgccaaac
actgaagagtgcccagtctacctggaattcgatttggtcacttacaacactgtacatcaa
atgaagcatcatctccaagagtctcttcagcagctcaatggtgatgtttttattgggcat
gcccttcagtggacagttgacaatgtctttgtaggaacccccaatctgaggaaaaacaaa
gttatctttatagtaactgcaggtgaaaccaaccctttagacaaagaagttttaaggaat
gcatctctgagagccaagtgccaaggctactccatatttgtattttcctttggtccgata
cacaatgacatggagttagaagaattagcaagccaccctctggatcatcacttagtccgg
cttggccgggtacacaggccagatttggactatgtcatcaagttcatcaagccatttgtt
cattcgatcagacgtgctatcaacaaatatcccggcagagacctgcaagccaagtgtgat
aatctcaccttccctggcccagagaatgctggcacagaagacagtgcattactcatcccc
gaggtgtacagaatcgaggcaggagagaatgagctgtctggagactctggatctcaggag
cagcatttcttcctcctagggaacagtcatggcaaccattcagaaagcactgctgatctg
atgcggcagttgtacctgctcctctcctccggggaactgatggtgaatgataaggaagag
ccttgttccgcagagaccccagctccagtgaacagcaaacaagatggcgaagatgcaaga
tga

DBGET integrated database retrieval system