KEGG   Mus musculus (mouse): 66505
Entry
66505             CDS       T01002                                 

Gene name
Zmynd11, 2210402G22Rik, BS69
Definition
(RefSeq) zinc finger, MYND domain containing 11
  KO
K23218  zinc finger MYND domain-containing protein 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66505 (Zmynd11)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    66505 (Zmynd11)
SSDB
Motif
Pfam: Bromodomain PWWP zf-MYND DMSP_lyase Bacillus_HBL Spore_III_AB
Other DBs
NCBI-GeneID: 66505
NCBI-ProteinID: NP_001186070
MGI: 1913755
Ensembl: ENSMUSG00000021156
Vega: OTTMUSG00000017437
UniProt: Q8R5C8 Q3UKS1 Q6PD13
Structure
PDB: 
4N4G 4N4I 4N4H

Position
13; 13 A1
AA seq 602 aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCFECHLPGEVLICDLCFR
VYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKHSNKQEMGTYLRFIVSRMKERAIDLNKKG
KDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADI
ARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS
SQEIPTMPQPIERVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKD
RMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFV
EEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRR
KR
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggcacgtttaacaaaaagacgacaggcggatacaaaagctatccagcatctttgggca
gccattgaaattatcagaaatcagaagcagattgccaacattgatcgtattacaaagtat
atgtcccgagtccacggtatgcatcccaaagagaccacccgccagctgagcttagctgtg
aaagatggtcttattgtcgaaactctaacagtgggctgcaaaggttcaaaagctggtatt
gaacaggaaggatattggttaccaggagatgagattgactgggaaacagaaactcatgac
tggtattgttttgaatgccatttgcctggagaggtgttgatatgtgacctgtgttttcgt
gtgtatcattccaagtgtttgtctgatgagttcaggcttagagacagcagtagtcactgg
cagtgcccagtttgcaggagcattaagaagaagcactctaacaagcaggaaatgggcacc
tacttgaggttcatcgtctcccgaatgaaggagcgggctatagaccttaataagaaagga
aaggacagtaagcatcctatgtaccggaggctggtccactcagctgttgacgtccctacc
atacaagagaaggtgaatgaggggaagtaccggagttacgaggagttcaaggctgacgca
cagctgcttctccacaacacagtgatcttctatggagcagacagtgagcaggcggacatt
gcacggatgttatataaagacacgtgtcacgagctggacgagctgcagctttgcaagaac
tgcttctatctgtcaaacgcacggcccgacaactggttctgctacccttgcatacctaat
catgagctggtttgggctaaaatgaaaggttttgggttttggccagccaaagtcatgcag
aaagaagacaatcaagtggatgttcgcttctttggccatcaccaccagagagcctggatt
ccttctgaaaacatccaggatatcacggtcaatgttcaccgactgcacgtgaagcgcagc
atgggctggaagaaggcctgtgacgagctggaactgcatcagcgcttcctccgtgaagga
aggttctggaagtctaagaatgaggaccgaggtgaggaagaggcagaatccagtatctcc
tccaccagtaacgagcagctgaaggtcactcaagagccaagagcaaagaaaggacgacgt
aatcagagtgtggagcccaaaaaggaagaacccgagccagaaacggaagcagtgagttcc
agccaggaaatccccacaatgcctcagccaattgagagggtgtcagtgtcaacccagacc
aagaagttaagtgcctcttccccacgaatgctgcatcgaagcactcagacgacgagcgac
ggcgtctgtcagagcatgtgccacgacaagtacaccaaaatttttaatgactttaaagac
aggatgaagtcggaccacaagcgggaaacagagagagtggtccgtgaagcgctggaaaag
ttgcgttctgaaatggaagaagaaaaaagacaggccgtgaacaaagctgtggccagcctg
cagggcgacatggacagaaagggtaagcagctgaaggagaagtgcaaggaagagtttgta
gaggagatcaagaagctagcggcgcagcacaagcagctcatttcccagaccaagaagaag
cagtggtgctacaactgtgaggaggaggccatgtaccactgctgctggaacacgtcctac
tgctccatcaagtgccagcaggagcactggcacgcagagcacaagcgcacctgccgccgg
aagagatga

DBGET integrated database retrieval system