KEGG   Mus musculus (mouse): 66513
Entry
66513             CDS       T01002                                 

Gene name
Tab1, 2310012M03Rik, Map3k, Map3k7ip1, b2b449C, b2b449Clo
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    66513 (Tab1)
   04064 NF-kappa B signaling pathway
    66513 (Tab1)
   04668 TNF signaling pathway
    66513 (Tab1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    66513 (Tab1)
   04621 NOD-like receptor signaling pathway
    66513 (Tab1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    66513 (Tab1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    66513 (Tab1)
   05161 Hepatitis B
    66513 (Tab1)
   05168 Herpes simplex virus 1 infection
    66513 (Tab1)
   05169 Epstein-Barr virus infection
    66513 (Tab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    66513 (Tab1)
   05135 Yersinia infection
    66513 (Tab1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    66513 (Tab1)
   05140 Leishmaniasis
    66513 (Tab1)
SSDB
Motif
Pfam: PP2C DUF4533
Other DBs
NCBI-GeneID: 66513
NCBI-ProteinID: NP_079885
MGI: 1913763
Ensembl: ENSMUSG00000022414
UniProt: Q8CF89
Structure
PDB: 
4LOO 4LOP 4LOQ

Position
15; 15 E1
AA seq 502 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDNWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNTEHTEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKALEREISGGAMAVVAVLLNSKLYV
ANVGTNRALLCKSTVDGLQVTQLNMDHTTENEDELFRLSQLGLDAGKIKQMGVICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAKFCPRHEDMTL
LVRNFGYPLGEMSQPTPTPAPGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGSH
SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYV
DFAEFYRLWSVDHGEQSVMTAP
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctccagagtgagcagcagccaagctggacagatgac
ctgccactctgtcacctctctggagttggttcagcgtccaaccgcagctactctgctgat
ggcaagggcactgagagccaccctccggaggacaactggcttaagttcagaagtgaaaat
aactgcttcctgtacggggtcttcaatggctatgatggcaaccgcgtgaccaactttgtg
gcgcagaggctttctgcagagctcctgctgggccagctcaacactgagcacactgaggct
gatgtgcgacgggtcctgctgcaggcctttgatgtggtggagaggagcttcctggagtct
atcgatgatgccttagctgagaaagcaagcctccagtcccagctgccggagggtgtgccc
cagcaccagctgccacctcagtaccagaagatccttgagagactcaaggcactggagagg
gagatttcgggaggagccatggctgtcgtggcagtccttctcaacagcaagctctacgtt
gccaatgtcggtacgaacagggcccttctgtgcaaatctacagtggatgggttacaggtt
acacagctaaacatggaccacaccaccgagaacgaggacgagctctttcggctttcgcaa
ctgggtttagacgcagggaagatcaagcagatgggcgtcatctgtggacaggagagcacc
aggcggattggggattacaaggtcaaatatggctacaccgacattgacctgctcagcgct
gccaagtccaaacccatcatcgcagagccggaaattcatggcgcacagcctctggatggc
gtgacgggcttcctggtgctgatgtcagaggggctgtacaaggccctggaggcagcccat
gggcctgggcaggccaaccaggagattgccgcgatgattgacaccgagtttgccaagcag
acctccctggatgcggttgcccaggctgtggtagaccgtgtaaagcggatccacagtgac
acctttgccagtggtggggagcgtgccaagttctgcccacggcatgaagacatgaccctg
ctggtgaggaactttggctatccattgggtgaaatgagccagcctacaccgacccctgcc
ccagggggccgtgtgtaccctgtttctgtgccctactcaagtgcccagagcaccagcaag
actagtgtgactctgtccctcgtcatgccttctcagggccagatggtcaacggctctcac
agtgcctccactctggacgaagccactcccacactcactaaccagagccccactctgacc
ctgcagtccaccaacacgcacacccagagcagcagctccagctctgacgggggcctcttc
cgctccagaccggctcactcacttccacccggagaggatggccgtgtggagccctatgtg
gactttgctgagttctaccgactctggagcgtggaccacggcgagcagagcgtgatgacg
gcaccttag

DBGET integrated database retrieval system