KEGG   Mus musculus (house mouse): 66513
Entry
66513             CDS       T01002                                 
Symbol
Tab1, 2310012M03Rik, Map3k7ip1, b2b449Clo
Name
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    66513 (Tab1)
   04064 NF-kappa B signaling pathway
    66513 (Tab1)
   04668 TNF signaling pathway
    66513 (Tab1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    66513 (Tab1)
   04621 NOD-like receptor signaling pathway
    66513 (Tab1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    66513 (Tab1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    66513 (Tab1)
   05161 Hepatitis B
    66513 (Tab1)
   05168 Herpes simplex virus 1 infection
    66513 (Tab1)
   05169 Epstein-Barr virus infection
    66513 (Tab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    66513 (Tab1)
   05135 Yersinia infection
    66513 (Tab1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    66513 (Tab1)
   05140 Leishmaniasis
    66513 (Tab1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    66513 (Tab1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    66513 (Tab1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 66513
NCBI-ProteinID: NP_079885
MGI: 1913763
Ensembl: ENSMUSG00000022414
UniProt: Q8CF89
Structure
Position
15:80017333..80045908
AA seq 502 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDNWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNTEHTEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKALEREISGGAMAVVAVLLNSKLYV
ANVGTNRALLCKSTVDGLQVTQLNMDHTTENEDELFRLSQLGLDAGKIKQMGVICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAKFCPRHEDMTL
LVRNFGYPLGEMSQPTPTPAPGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGSH
SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYV
DFAEFYRLWSVDHGEQSVMTAP
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctccagagtgagcagcagccaagctggacagatgac
ctgccactctgtcacctctctggagttggttcagcgtccaaccgcagctactctgctgat
ggcaagggcactgagagccaccctccggaggacaactggcttaagttcagaagtgaaaat
aactgcttcctgtacggggtcttcaatggctatgatggcaaccgcgtgaccaactttgtg
gcgcagaggctttctgcagagctcctgctgggccagctcaacactgagcacactgaggct
gatgtgcgacgggtcctgctgcaggcctttgatgtggtggagaggagcttcctggagtct
atcgatgatgccttagctgagaaagcaagcctccagtcccagctgccggagggtgtgccc
cagcaccagctgccacctcagtaccagaagatccttgagagactcaaggcactggagagg
gagatttcgggaggagccatggctgtcgtggcagtccttctcaacagcaagctctacgtt
gccaatgtcggtacgaacagggcccttctgtgcaaatctacagtggatgggttacaggtt
acacagctaaacatggaccacaccaccgagaacgaggacgagctctttcggctttcgcaa
ctgggtttagacgcagggaagatcaagcagatgggcgtcatctgtggacaggagagcacc
aggcggattggggattacaaggtcaaatatggctacaccgacattgacctgctcagcgct
gccaagtccaaacccatcatcgcagagccggaaattcatggcgcacagcctctggatggc
gtgacgggcttcctggtgctgatgtcagaggggctgtacaaggccctggaggcagcccat
gggcctgggcaggccaaccaggagattgccgcgatgattgacaccgagtttgccaagcag
acctccctggatgcggttgcccaggctgtggtagaccgtgtaaagcggatccacagtgac
acctttgccagtggtggggagcgtgccaagttctgcccacggcatgaagacatgaccctg
ctggtgaggaactttggctatccattgggtgaaatgagccagcctacaccgacccctgcc
ccagggggccgtgtgtaccctgtttctgtgccctactcaagtgcccagagcaccagcaag
actagtgtgactctgtccctcgtcatgccttctcagggccagatggtcaacggctctcac
agtgcctccactctggacgaagccactcccacactcactaaccagagccccactctgacc
ctgcagtccaccaacacgcacacccagagcagcagctccagctctgacgggggcctcttc
cgctccagaccggctcactcacttccacccggagaggatggccgtgtggagccctatgtg
gactttgctgagttctaccgactctggagcgtggaccacggcgagcagagcgtgatgacg
gcaccttag

DBGET integrated database retrieval system