KEGG   Mus musculus (mouse): 66514
Entry
66514             CDS       T01002                                 

Gene name
Asrgl1, 2410004D18Rik, A, ALP, ALP1, AU040643, AW060375
Definition
(RefSeq) asparaginase like 1
  KO
K13051  L-asparaginase / beta-aspartyl-peptidase [EC:3.5.1.1 3.4.19.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    66514 (Asrgl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    66514 (Asrgl1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     66514 (Asrgl1)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     66514 (Asrgl1)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T2
   66514 (Asrgl1)
Motif
Pfam: Asparaginase_2
Other DBs
NCBI-GeneID: 66514
NCBI-ProteinID: NP_079886
MGI: 1913764
Ensembl: ENSMUSG00000024654
Vega: OTTMUSG00000028355
UniProt: Q8C0M9
Position
19; 19 A
AA seq 326 aa
MACARGTVAPPVRASIDVSLVVVVHGGGASNISANRKELVREGIARAATEGYKILKAGGS
AVDAVEGAVTVLENDPEFNAGYGSVLNVNGDIEMDASIMDGKDLSAGAVSAVRCIANPVK
LARLVMEKTPHCFLTGHGAEKFAEDMGIPQVPVEKLITERTKKHLEKEKLEKGAQNADCP
KNSGTVGAVALDCRGNLAYATSTGGIVNKMVGRVGDSPCIGAGGYADNNLGAVSTTGHGE
SILKVNLARLALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM
PWAAVKNGKLQAGIDLCETRTRDLPC
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcgtgcgcccgcggcaccgtggcgccgccagtccgagcctccatcgatgtgagtctc
gtggtggtagtccatggtggcggagcaagcaacatctcagccaaccggaaagagctggtg
cgcgagggcatcgccagagcggcaaccgagggctacaaaatcctcaaggcgggagggagc
gcggtagatgctgtggaaggagccgtgactgtcctggaaaacgacccagagttcaacgca
ggttatgggtctgtcctgaatgtaaacggtgatattgagatggatgctagtatcatggat
gggaaggacctgtctgcaggtgcagtgtctgccgtgcgctgtatcgcaaatcccgttaaa
cttgcacggcttgttatggaaaagacacctcattgctttctgactggccatggtgcagag
aaatttgcagaagacatggggattccacaggtccctgtagaaaaactgataactgagaga
accaagaagcacctggagaaagagaagcttgagaagggagcacagaatgctgactgccct
aaaaactcaggaactgtgggtgctgttgccttggactgcagaggaaacttggcttacgca
acctctactggggggattgtcaataaaatggttggccgagttggagactcgccttgcata
ggagctggaggttacgcagataataaccttggagccgtttcaaccacaggacatggggaa
agtatcctgaaggtgaatctggccagacttgccctcttccatgtagagcaaggaaagacc
gtagaggaggctgctcagttggcattggattacatgaagtcaaaactcaaaggtctaggt
ggcctcatcttggtcaacaaaacaggagactgggtggcaaagtggacctctgcctccatg
ccctgggcagcggtgaagaatggcaagctgcaggccggcattgacctctgtgagaccagg
acaagggacctaccttgctag

DBGET integrated database retrieval system