KEGG   Mus musculus (mouse): 66515
Entry
66515             CDS       T01002                                 

Gene name
Cul7, 2510004L20Rik, AA409809, C230011P08Rik, p18, p185, p19, p193
Definition
(RefSeq) cullin 7
  KO
K10613  cullin 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    66515 (Cul7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66515 (Cul7)
   03036 Chromosome and associated proteins [BR:mmu03036]
    66515 (Cul7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul7 complex
    Cullin
     66515 (Cul7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   3M complex
    66515 (Cul7)
SSDB
Motif
Pfam: Cul7 Cullin ANAPC10 Cullin_Nedd8
Other DBs
NCBI-GeneID: 66515
NCBI-ProteinID: NP_079887
MGI: 1913765
Ensembl: ENSMUSG00000038545
Vega: OTTMUSG00000024273
UniProt: Q8VE73 A9C491
Position
17; 17 C
AA seq 1689 aa
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHNGHPEYQIRWLILRRGDDGDRDSTVDCK
AEHILLWMSDDEIYANCHKMLGENGQVIAPSRESTEAGALDKSVLGEMETDVKSLIQRAL
RQLEECVGTVPPAPLLHTVHVLSAYASIEPLTGIFKDRRVVNLLMHMLSSPDYQIRWSAG
RMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLTEHPMSFEGVQL
PQVPGRLLFSLVKRYLHVTFLLDRLNGDAGDQGAQNNFIPEELNVGRGRLELEFSMAMGT
LISELVQAMRWDGASSRPESSSSSTFQPRPAQFRPYTQRFRRSRRFRPRASFASFNTYAL
YVRDTLRPGMRVRMLENYEEIAAGDEGQFRQSNDGVPPAQVLWDSTGHTYWVHWHMLEIL
GFEEDIEDVIDIEELQELGANGALSIVPPSQRWKPITQLFAEPYVVPEEEDREESENLTQ
AEWWELLFFIRQLSEAERLHIVDLLQDHLEEERVLDYDMLPELTVPVDLAQDLLLSLPQQ
LEDSALRDLFSCSVYRKYGPEVLVGHLSYPFVPGAQPNLFGANEESEAKDPPLQSASPAL
QRLVESLGPEGEVLVELEQALGSEAPQETEVKSCLLQLQEQPQPFLALMRSLDTSASNKT
LHLTVLRILMQLVNFPEALLLPWHEAMDACVTCLRSPNTDREVLQELIFFLHRLTTTSRD
YAVILNQLGARDAISKVLEKHRGKLELAQELRDMVSKCEKHAHLYRKLTTNILGGCIQMV
LGQIEDHRRTHRPIQIPFFDVFLRYLCQGSSEEMKKNRYWEKVEVSSNPQRASRLTDRNP
KTYWESSGRAGSHFITLHMRPGVIIRQLTLLVAGEDSSYMPAWVVVCGGNSIKSVNKELN
TVNVMPSASRVTLLENLTRFWPIIQIRIKRCQQGGINTRIRGLEVLGPKPTFWPVFREQL
CRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRHEQNFAERFLPDMEAAQALSKT
CWEALVSPLVQNITSPDEDSTSSLGWLLDQYLGCREAAYNPQSRAAAFSSRVRRLTHLLV
HVEPREAAPPVVAIPRSKGRNRIHDWSYLITRGLPSSIMKNLTRCWRSVVEEQMNKFLTA
SWKDDDFVPRYCERYYVLQKSSSELFGPRAAFLLAMRNGCADAVLRLPFLRAAHVSEQFA
RHIDQRIQGSRMGGARGMEMLAQLQRCLESVLIFSPLEIATTFEHYYQHYMADRLLSVGS
SWLEGAVLEQIGPCFPSRLPQQMLQSLNVSEELQRQFHVYQLQQLDQELLKLEDTEKKIQ
VAHEDSGREDKSKKEEAIGEAAAVAMAEEEDQGKKEEGEEEGEGEDEEEERYYKGTMPEV
CVLVVTPRFWPVASVCQMLNPATCLPAYLRGTINHYTNFYSKSQSRSSLEKEPQRRLQWT
WQGRAEVQFGGQILHVSTVQMWLLLHLNNQKEVSVESLQAISELPPDVLHRAIGPLTSSR
GPLDLQEQKNVPGGVLKIRDDSEEPRPRRGNVWLIPPQTYLQAEAEEGRNMEKRRNLLNC
LVVRILKAHGDEGLHVDRLVYLVLEAWEKGPCPARGLVSSLGRGATCRSSDVLSCILHLL
VKGTLRRHDDRPQVLYYAVPVTVMEPHMESLNPGSAGPNPPLTFHTLQIRSRGVPYASCT
DNHTFSTFR
NT seq 5070 nt   +upstreamnt  +downstreamnt
atggtaggggagctacgatacagggaattcagggtgcccctggggcctggcttgcacgcg
tatccggatgaattgatccgccaacgggttggccataatgggcaccccgagtatcagatc
cgctggctcatcctcaggcgcggggatgatggggaccgggactctacagtggactgcaag
gctgagcatatcctgttatggatgtctgacgatgagatctatgccaactgccacaagatg
ctgggcgagaatggccaagtcatcgcaccttcccgggagtccactgaggcaggggccctc
gacaagtctgtgctgggggagatggaaacagatgtgaagtccttgattcagagggccctt
cggcagctggaggagtgcgtgggcaccgtgcctcctgcccctctccttcacacggtccat
gtactcagtgcctatgccagcatcgagcccctcactggcatcttcaaagaccgcagggtt
gtgaacttgctcatgcacatgttgagcagtcctgattatcagatccgctggagcgcaggc
cggatgatccaagctctgtcctcccacgatgctgggacccggacccagatccttctgtca
ttgagccaacaagaggccattgaaaagcacctggattttgatagccgctgcgctctgctt
gcactgttcgcccaggctactctcacggaacacccgatgtctttcgagggcgttcagctg
ccacaggtcccaggacggctgctcttctccctggtaaaacgctacctgcacgtcaccttc
ctcctggatcggctgaacggcgatgcaggggatcaaggagcccagaacaactttattcct
gaggagttgaatgtagggaggggccggctggaactggaattcagtatggccatgggcact
ctgatctctgagctggtgcaggccatgcgctgggacggggcctcaagcagaccagagagt
tcttcctcctccaccttccagcctcggccagcacagttccgcccctacacccagcgtttc
aggaggtcgaggcggtttcgcccccgtgcctcgtttgccagttttaatacctatgccttg
tatgtgcgggacacgctgcggcccgggatgcgggtacggatgctggagaattacgaggag
atcgctgctggggatgagggccagttccgacagagcaatgatggcgttcccccagcgcag
gtgttgtgggattcaacaggccatacctactgggtgcactggcacatgctggagatcttg
ggctttgaggaagacatcgaggatgtgattgatattgaagagttacaggagctaggggcc
aatggagcactgagcatcgtcccgccgtcccagcgctggaagcccataactcagctcttt
gccgagccttacgtggtacccgaggaggaagacagggaagagagcgagaacttgacccag
gctgagtggtgggagctcctcttcttcatccggcagttgagtgaggcagagcgccttcac
atcgtggatctcctgcaagaccacctggaagaggagcgcgttctggactacgatatgctg
cctgagctgaccgtgcccgttgacttggcccaggatctgctgttgtctctgcctcagcaa
cttgaggacagtgctctgagggacctgttcagctgcagtgtctacaggaagtatgggccc
gaagtcctggtagggcatctaagctacccatttgtgccaggtgcccagccaaatttattc
ggagccaatgaagagtctgaagccaaagatcccccacttcagagtgccagccctgccctg
cagcgcctggtggagagcttgggccccgaaggggaggtccttgtggaactggaacaagcc
ctcggctccgaggctccccaggaaactgaggtcaagtcctgcttgttgcagctccaggag
cagccccagcccttcctcgctctgatgcggagcctggacacttccgccagcaacaagacc
ctgcacctcactgtgctcagaatcttaatgcagctggtgaacttcccagaggcgctgttg
ctaccctggcacgaggccatggatgcctgcgtgacctgccttcggtcccccaatactgac
cgagaggtgctccaggaactaatctttttcctgcaccgcctgaccaccacaagccgggac
tatgcggtgatactaaaccagctaggagcccgggacgccatctccaaagtcctggaaaag
caccgagggaaactggagttggctcaggagctgcgggatatggtgtccaagtgtgagaag
catgcccacctctaccggaaactcaccaccaacatcctgggcggttgcatccagatggtc
ctgggtcagattgaagaccacagacgaacccaccggcccatccaaatcccattctttgat
gtgtttctcagatatctgtgccagggctccagtgaggaaatgaagaaaaacaggtactgg
gagaaggtggaggtgtcctccaacccacagcgggccagcaggctgacggaccgcaacccc
aagacctactgggagtccagtggcagggccggctcccacttcatcaccttacacatgcgc
ccaggtgtcatcatcaggcagctgactctactggtggctggcgaggactcaagctacatg
ccagcctgggtggtggtatgcgggggcaacagcatcaagtccgttaataaagaactcaac
acggtaaacgtgatgccctctgccagccgggtgaccctcctggagaacctgacccgcttc
tggcccatcatccaaatcagaataaagcgctgccagcagggtggcattaacacgcgcatc
cggggcctagaggtgctgggccccaagcccaccttctggccagtgttccgagagcaactg
tgccggcacacgcgcctcttctacatggttcgggcccaggcatggagtcaggacatagca
gaggaccgccggagccttctgcacctgagttctaggctaaatggggctctgcgccatgaa
cagaattttgcagagcgcttccttcctgatatggaggccgcccaagcactgagcaagacc
tgctgggaggcgctggtcagccccctggtgcagaacattacatctcccgatgaggacagc
accagctccttgggctggctgctggatcagtacttgggatgcagggaggctgcctacaat
ccccagagcagggctgctgctttctcctcccgggttcgccgccttacccacctcctggtc
catgtggagccccgtgaggcagcacctccggtggtggccatccctcgatccaagggcagg
aacagaatccatgactggagctacttgatcacccggggccttccaagtagcatcatgaag
aacctgacccgctgttggcggtctgtggtggaggagcagatgaacaagtttctgactgcg
tcctggaaagacgatgatttcgtaccccgctattgcgagcgctattacgtcctgcagaag
tccagctcagagctgtttgggccacgagctgccttcttgctggcaatgcggaatggctgt
gctgatgctgtgctgaggctccctttcctcagggccgcccatgtgagcgagcagtttgct
cggcacattgaccagaggatccaaggcagtaggatgggtggagcccggggaatggagatg
ctggcacagttgcagcgatgcctggagtctgtcctgattttctctcccctggagatagcc
accacctttgagcattactaccagcactacatggctgaccgtctcctgagcgtaggctcc
agctggctggagggggccgtactggagcagatcggtccctgcttccccagccgtcttccc
cagcagatgctacagagcctgaacgtctcagaggagttgcagcgtcagttccacgtttac
cagctgcagcagcttgatcaggagctcctgaagctggaagacacggaaaagaagatacag
gtggcccatgaggacagtggcagagaggacaagagcaagaaggaagaagccattggagaa
gccgcggctgtggctatggcagaggaggaggatcaagggaagaaggaggagggagaggag
gaaggggagggagaggatgaggaggaagagcgctattataaaggaacaatgccagaagtg
tgtgtacttgtcgtgacgccacgcttctggcctgtcgcctccgtctgccaaatgctcaac
ccggcaacgtgcctgcccgcatacctgcgggggaccataaaccactacaccaacttttac
agcaagagtcagagccgctccagcttagagaaagagccacagaggcggctgcagtggacc
tggcagggccgggcagaagtgcagttcgggggtcagattctgcatgtgtccacagtacag
atgtggctgctgctgcatctcaacaaccaaaaggaggtgtctgtcgagagcctgcaggct
atctcggagctccctccagatgtgcttcacagggccatcgggcctctcacctcatcaaga
ggtcccttggacctgcaggagcagaagaacgtaccaggaggggtgctcaagattcgagat
gacagtgaggaacccaggccgaggaggggcaacgtgtggctgatcccacctcagacatac
ctacaagctgaggccgaagagggccggaacatggagaagagaaggaatcttctgaattgc
cttgttgtccgaatcctcaaggctcacggggatgaaggcttgcatgttgaccggctcgtc
tatctggtgctagaagcgtgggagaaaggcccgtgtcctgctaggggtctggtcagcagc
ctcggcaggggagcaacctgcaggagctctgatgtcctctcctgcatcctgcacctcctg
gtcaagggcacgctgagacgccatgacgaccggccgcaggtgctgtactatgcagttcct
gtaactgtgatggagccccacatggagtccctgaaccctggctcggcaggccccaatcca
cccctcaccttccacaccctgcagattcgatcccggggtgtgccttacgcctcctgcact
gataaccacaccttctccactttccggtag

DBGET integrated database retrieval system