KEGG   Mus musculus (house mouse): 66528
Entry
66528             CDS       T01002                                 
Symbol
Smim5, 2210020M01Rik
Name
(RefSeq) small integral membrane protein 5
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SMIM5_18_22 TMEM52
Other DBs
NCBI-GeneID: 66528
NCBI-ProteinID: NP_899082
MGI: 1913778
Ensembl: ENSMUSG00000048442
UniProt: Q8BT42
Position
11:115789575..115797095
AA seq 78 aa
MAATDFVGEIRSVGERLLLKLQQLPQAEPVELVAFSIIVLFTATVLVLGLIACSCCCAHC
CCSESRQRKIPVRPTKPR
NT seq 237 nt   +upstreamnt  +downstreamnt
atggcagccacagactttgtgggggagattcgctctgtgggagagaggctgctgctgaaa
ctgcaacaactcccccaggcggagcccgtggagctcgtggctttctccatcattgttctt
ttcacagctactgtcctggtgctggggctgatagcctgcagctgctgctgtgctcactgc
tgctgctctgagagcagacagcggaagatcccggtgcggcccacaaaacccagatga

DBGET integrated database retrieval system