KEGG   Mus musculus (mouse): 665301
Entry
665301            CDS       T01002                                 

Gene name
Gm20773
Definition
(RefSeq) predicted gene, 20773
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Spin-Ssty
Other DBs
NCBI-GeneID: 665301
NCBI-ProteinID: XP_011249347
MGI: 5434129
Ensembl: ENSMUSG00000095900
Vega: OTTMUSG00000050539
UniProt: A0A0A6YXW2
Position
Y; Y A1
AA seq 232 aa
MSSLMKKRRRKSSSNTLRNIVGCRISHSWKEGNEPVTQWKAIVLDQLPTNPSLYLVKYDG
IDSIYGLELYSDDRILNLKVLPPIVVFPQVRDAHLARALVGRAVQHKFEGKDGSEVNWRG
VVLAQVPIMKDLFYITYKKDPALYAYQLLDDYKEGNLHMIPDTPPAEERSGDDSDVLIGN
WVEYTRKDGSKKFGKVVYQVLANPSVYFIKFHGDIHIYVYTMVPKIFKVEKS
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcatccctcatgaagaagaggaggaggaagtcttcttccaacaccctgaggaatatt
gtcggctgcagaatttctcacagttggaaggaaggtaatgagcctgtcacccaatggaag
gccatagttctagatcaactgccaacaaacccttctctttacttggtgaagtatgatgga
attgacagcatctacggactggagctctacagtgatgacaggattttaaaccttaaggtt
ttgcctcccatagtagtatttcctcaggtgagggatgcccacctcgccagagccctggtt
ggcagagcggtacaacacaaatttgaggggaaagatggctctgaggtcaactggaggggg
gtggtgctagcccaggtgccaatcatgaaggatttgttttacattacctacaagaaggat
ccagctctctatgcttatcagctcctggatgactacaaggaaggtaacctccacatgatt
ccagacactcctccggctgaggagagatcaggagatgacagtgatgtgttgattggtaac
tgggtggaatacaccagaaaagatggttccaaaaagttcggaaaggttgtttaccaagtt
ctagccaatccttccgtgtactttatcaagtttcatggtgacatccatatctatgtctat
actatggtgccaaagatttttaaagttgaaaaatcataa

DBGET integrated database retrieval system