KEGG   Mus musculus (mouse): 66540Help
Entry
66540             CDS       T01002                                 

Gene name
Fam107b, 3110001A13Rik, AA589595, AA959793, AI132312
Definition
(RefSeq) family with sequence similarity 107, member B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1151
Motif
Other DBs
NCBI-GeneID: 66540
NCBI-ProteinID: NP_079902
MGI: 1913790
Ensembl: ENSMUSG00000026655
Vega: OTTMUSG00000010781
UniProt: Q3TGF2
Position
2; 2 A1
AA seq 131 aa AA seqDB search
MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKR
RRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRR
TGQEVAQAQES
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccagactacatagaagatgacaatcctgagctaattaggccccagaagctt
atcaaccctgtcaaaagctcccgaaatcaccaagacctccacagagagcttcttatgaat
cagaaaagaggtcttgcccctcagaataaaccagaactgcagaaggtgatggagaagaga
agacgagaccaagtgataaagcagaaggaggaagaagctcagaagaagaaatccgacctg
gaaatagaactattaaagcgacagcagaagctggagcagcttgaacttgagaagcagaaa
ttgcaagaagagcaagaaaatgccccagagtttgtgaaggtgaaaggcaatctcaggaga
acaggccaagaggtggctcaggcccaggagtcctag

DBGET integrated database retrieval system