KEGG   Mus musculus (mouse): 665433Help
Entry
665433            CDS       T01002                                 

Gene name
Hist1h2ao, Hist1h2ap
Definition
(RefSeq) histone cluster 1, H2ao
  KO
K11251  histone H2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu05034  Alcoholism
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    665433 (Hist1h2ao)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    665433 (Hist1h2ao)
  09165 Substance dependence
   05034 Alcoholism
    665433 (Hist1h2ao)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    665433 (Hist1h2ao)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    665433 (Hist1h2ao)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    665433 (Hist1h2ao)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   665433 (Hist1h2ao)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 665433
NCBI-ProteinID: NP_001171015
MGI: 2448302
Ensembl: ENSMUSG00000094248
Vega: OTTMUSG00000000457
UniProt: C0HKE1 C0HKE2 C0HKE3 C0HKE4 C0HKE5 C0HKE6 C0HKE7 C0HKE8 C0HKE9 B2RVF0
Structure
PDB: 

Position
13; 13 A3.1
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggtggcaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcagttccccgtgggccgcgtgcaccggctgctccgcaagggcaactac
tcggagcgcgtgggcgccggcgccccggtctacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accgagagccaccacaaggccaagggaaaataa

DBGET integrated database retrieval system