KEGG   Mus musculus (house mouse): 66548
Entry
66548             CDS       T01002                                 
Symbol
Adamtsl5, 2010109H09Rik, Thsd6
Name
(RefSeq) ADAMTS-like 5
  KO
K24432  ADAMTS-like protein 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    66548 (Adamtsl5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  ADAMTS-like proteins
   66548 (Adamtsl5)
SSDB
Motif
Pfam: ADAMTS_spacer1 NTR ADAMTS_CR_3 TSP_1 TSP1_spondin TSP1_CCN TSP1_ADAMTS
Other DBs
NCBI-GeneID: 66548
NCBI-ProteinID: NP_001272364
MGI: 1913798
Ensembl: ENSMUSG00000043822
UniProt: Q9CRC7 D3Z689
Position
10:complement(80175627..80184282)
AA seq 485 aa
MAIHPDPALHCLLVTLCSLKPRLFPLLPFLLWTLLSCDLRGAAQGPGEWTPWGSWSRCSS
SCGRGVSVRRRQCVRLPGEELCWGDSHEYRVCQLPDCPPGTTPFRDLQCSLYNGHPVLDT
QKTYQWVPFHGAPNVCDLNCLAEGHAFYHSFGRVLDGTPCTPGTQGLCVAGRCLSAGCDG
ILGSGTLEDRCGLCGGANDSCLFVQRVFRDAGAFAGFWNVTLIPEGARHIRVAQRSHNHL
ALVTRGGHYVLNGDGVLSPPGTYEAAGTRVVYTRSAGPEETLQATGPTSQELLLQVLLRE
PNPGVHFEFWLPRERYGPFQAQVQALGWPLRQPQPREVEPQPAETPVVPEAIPARVASLP
PDPCGPCPDSRGRAHRLLHYCGSDFVFQARVLGRHRQAQETRYEVRVLLIYKSRTPLRTR
EYVWAPGHCPCPPLAPHREYLLAARRLVSPDGTQDRLLLPHAGYARLWSPAEDSRVRLAA
RRCPV
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcaattcaccctgaccctgctcttcactgcctcttggtaaccctgtgctccctcaaa
ccccgcctcttcccgcttcttccgttcttgctgtggactctcctgagctgtgatttgagg
ggtgctgcccagggtccgggagagtggacgccctgggggtcttggagcaggtgttccagc
tcttgtggtcggggcgtctcagtgcgcagacgccaatgtgtccgacttcccggagaggaa
ctttgttggggcgacagccatgaataccgggtgtgccagctgccggactgccctccaggg
accacaccattccgagacctgcagtgttctctctacaatggccaccctgtcctggacacc
cagaaaacctaccagtgggtgcccttccacggggcgcccaatgtgtgtgacctcaactgc
ctagctgaaggccacgccttctaccacagctttggccgcgtgctggatggcaccccctgc
accccgggtacccagggtctctgcgtggcaggccgctgtctgagcgcaggctgtgacggg
atactgggctccggcaccctcgaggaccgctgcggcctctgtggtggcgctaacgactct
tgcctgttcgtgcagcgcgtgttccgcgacgccggtgccttcgccggcttctggaatgtg
actttgatccccgagggcgccaggcacatccgcgtagcacagcgcagccacaaccacctg
gcgctggttacccgcggcgggcactacgtgctcaacggtgatggggtgctcagcccgcct
ggcacctacgaggctgcgggcacccgagtggtttacacccggagtgcgggcccagaggag
actctgcaggcgaccggccccacctcccaggagctgctgttacaggtgctgctgcgggag
cccaacccaggcgtacacttcgagttctggctgccccgggagcgctatggcccctttcag
gctcaggtgcaggccctgggctggcccttgcgacagcctcagcctcgggaggtggagcca
cagcctgcagagactcctgtagtccccgaggccatccctgcccgtgttgcatccctgcca
ccagacccctgcgggccatgccccgacagccgtggtcgcgcacaccggcttcttcactac
tgtggcagcgactttgtgttccaggcccgtgtgctgggccgccaccgccaggcccaggag
acccgctacgaagtgcgggtcttgctcatctacaaaagccgcacgcctctgcgtactcga
gaatatgtatgggcaccaggccactgtccgtgcccaccactggccccacaccgagaatac
ctgttggctgccaggcgactcgtaagccctgatggcacgcaggatcggctactgctgcct
cacgctggctatgctcgactctggagtcccgcggaggacagcagagttcggctggctgcc
cggcgctgtccagtctaa

DBGET integrated database retrieval system