KEGG   Mus musculus (mouse): 66552Help
Entry
66552             CDS       T01002                                 

Gene name
Sppl2a, 2010106G01Rik, C130089K23Rik
Definition
(RefSeq) signal peptide peptidase like 2A
  KO
K09596  signal peptide peptidase-like 2A [EC:3.4.23.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    66552 (Sppl2a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     66552 (Sppl2a)
Peptidases [BR:mmu01002]
 Aspartic Peptidases
  Family A22: presenilin family
   66552 (Sppl2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_A22B PA Presenilin PIG-Y
Motif
Other DBs
NCBI-GeneID: 66552
NCBI-ProteinID: NP_075709
MGI: 1913802
Ensembl: ENSMUSG00000027366
Vega: OTTMUSG00000015962
UniProt: Q9JJF9
Position
2; 2 F1
AA seq 523 aa AA seqDB search
MGLLHSLHAPAAALLWSCLLGLAAAQEAILHASTNGVSSLSKDYCMYYNNNWTRLPSSLE
NATSLSLMNLTGTALCHLSDIPPDGIRNKAVVVHWGPCHFLEKARIAQEGGAAALLIANN
SVLIPSSRNKSTFQNVTVLIAVITQKDFKDMKETLGDDITVKMYSPSWPNFDYTLVVIFV
IAVFTVALGGYWSGLIELENMKSVEDAEDRETRKKKDDYLTFSPLTVVVFVVICCIMIVL
LYFFYRWLVYVMIAIFCIASSMSLYNCLSALIHRMPCGQCTILCCGKNIKVSLIFLSGLC
ISVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTMKLPNFMSCVILLGLLLIYDVFFVF
ITPFITKNGESIMVELAAGPFENAEKLPVVIRVPKLMGYSVMSVCSVPVSVLGFGDIIVP
GLLIAYCRRFDVQTGSSIYYISSTIAYAVGMIITFVVLMVMKTGQPALLYLVPCTLITVS
VVAWSRKEMKKFWKGSSYQVMDHLDYSTNEENPVTTDEQIVQQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgcactcgctgcacgctcccgcggctgccctgctctggagctgcctgctc
ggactggcagctgctcaggaagccattctgcatgcgtctacaaatggcgtgtcttcactt
tccaaggactactgcatgtattataacaacaactggacacgacttccaagttccctagaa
aatgcaacttctctgagcttgatgaatctgacgggcacagcactgtgccacctttctgat
attcctcctgatggcataaggaacaaggcagtggtggtgcactggggaccctgccatttt
cttgaaaaagccagaattgcacaggaaggtggtgctgcagcattgctgattgccaacaac
agtgtcctaattccttcctcaaggaacaaatctacatttcaaaatgtgactgtactaatt
gcagttataacccaaaaagacttcaaagacatgaaagagactcttggagatgacattacc
gtgaaaatgtattccccatcctggcctaactttgactatactctggtggttatttttgta
attgctgtgttcactgtggccttaggaggatactggagtggacttattgaattggaaaac
atgaagtcagtggaagacgcagaagacagagagacaagaaaaaagaaggacgattactta
acattcagtcctctcacggttgttgtgttcgtggtcatctgctgtataatgattgtctta
ctgtatttcttctacaggtggcttgtgtatgttatgatagcgattttctgcatagcatcg
tcaatgagcctgtacaactgtctttctgcattgattcataggatgccatgtggacagtgc
acgattttgtgttgtggcaaaaacattaaagtgagcctgattttcctttccgggctgtgc
atctcagttgctgttgtgtgggctgtatttcgaaatgaggataggtgggcttggatttta
caggatatcttaggaattgctttctgtctcaacttaattaaaacaatgaagttacccaat
ttcatgtcatgcgtgatactgctaggccttcttctcatctacgatgtgttctttgtcttc
atcacacctttcatcacaaagaatggtgagagcatcatggtggaacttgctgctgggcct
ttcgagaatgctgaaaagttgccagtagttatcagggtgccaaaactgatgggttactca
gtcatgagtgtatgctccgtgcctgtttcagtattgggtttcggagatatcattgtacca
ggcctgttgattgcatattgtagaagattcgatgttcagactggttcttctatatactat
atttcatccacaattgcctatgctgttggcatgatcattacctttgttgtcctgatggtg
atgaaaacagggcagcctgctctcctctacttggtaccttgtacacttattactgtctca
gtcgttgcttggagtcgtaaggaaatgaaaaagttctggaaaggcagcagctatcaggtg
atggaccacctggactattcaacaaatgaagaaaatccagtgacgactgatgagcagatt
gtacaacagtaa

DBGET integrated database retrieval system