KEGG   Mus musculus (house mouse): 66568
Entry
66568             CDS       T01002                                 
Symbol
Rwdd3, 2510027J23Rik, 3110037C01Rik, AI035684, AI662458, Rsume, X2CR1
Name
(RefSeq) RWD domain containing 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: RWD DUF1115
Other DBs
NCBI-GeneID: 66568
NCBI-ProteinID: NP_079913
MGI: 1920420
Ensembl: ENSMUSG00000028133
UniProt: Q3UYX7 E9Q1R6
Position
3:complement(120949046..120965427)
AA seq 339 aa
MVEEVRQELSALAAIFCGPNEWEMLSCSDGAQCPPRETQLLQIVGIHHKHLCITSLTTGR
CSWLSATWKAVRKCLLRLLKNGSRFQTSAGRSMETFSSNPETDGAVFRIHTTAEGLVGED
VPLELAFHLPVGYPLCLPGISVTSEHLTRAQCVTAKEKLLGEARKLVSEPMVHELVLWIQ
QNLRLVLSQPETASSHEKCTLPESATGDDGPWMTLLRLDHMRARTKYVKAVEKWASELRL
TGRLMFMGKLILILLQGDRSNIKEYLILQKTSKVDVDSSGKKCKEKMISVLSETKVQTEH
KRFLAFEVKEYSTLEELQKEFGAAGLGELFSECVLGLVK
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggtggaggaggtgcggcaggagctctcggcgctggccgcgatcttctgcgggcccaac
gagtgggagatgttgagctgttcagacggtgcgcagtgccctcctcgtgaaacccagctc
ctccaaatagtcggcatccaccataagcatttgtgtatcacgtccctgacaacaggacgc
tgtagttggttgtcagccacgtggaaggcagtcaggaaatgcttgttaaggctgctgaaa
aatggcagccgattccagacttctgctggacgcagcatggagaccttctcttctaaccca
gagacagatggggctgtgtttagaattcacacaacagctgaaggacttgtgggtgaggat
gtgcccttagagttggcgttccatttaccagttggttaccctttgtgtctacccggcatc
tcggttacctcggaacatctgaccagggcccagtgtgttaccgcgaaggagaagttactt
ggagaagccaggaagctcgtgtcagaaccgatggttcacgagctggttctttggatccag
cagaatctcagacttgtcctcagccagccggagaccgccagcagccatgagaagtgcact
ttgccagaaagtgcgacgggggacgatggaccgtggatgactcttttgcgtttagatcac
atgagagcgaggactaaatatgtcaaagccgtggagaagtgggcttcagagttaaggctg
acaggaagactgatgttcatgggtaaattaatactgattttactacaaggagacagaagc
aacatcaaggagtacctgattcttcagaaaacctccaaagtagatgtggactcaagtgga
aagaaatgcaaagagaaaatgattagtgtactgtctgaaacaaaagtacaaacggaacac
aaaaggtttctggcgtttgaagtcaaagagtattcaacactggaggagttacaaaaggaa
ttcggagctgcaggacttggggagctcttctcagagtgtgtactggggctggtgaaatga

DBGET integrated database retrieval system