KEGG   Mus musculus (mouse): 66570
Entry
66570             CDS       T01002                                 

Gene name
Cenpm, 2610019I03Rik, AI853711, Pane1
Definition
(RefSeq) centromere protein M
  KO
K11505  centromere protein M
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66570 (Cenpm)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     66570 (Cenpm)
SSDB
Motif
Pfam: CENP-M
Other DBs
NCBI-GeneID: 66570
NCBI-ProteinID: NP_079915
MGI: 1913820
Ensembl: ENSMUSG00000068101
UniProt: Q9CQA0
Position
15; 15 E1
AA seq 180 aa
MSVLRSMDKLPDLNRATVLLVSTEDALLQQLAESMLKDDCASELRVHLANSLPLPSNVNR
PRIDLIVFVINLHSKYSLQKVEEFLQHVDSSFFLGKVCFLVTGAGQESHCSVHQNTVIKL
AHTYRSPLLLCDLQVESFRAAMARRLVRILQICAGHVPGVSALNLMSLLRSPENPPSKEL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtcggtgctgaggtcgatggacaagctgcccgacctgaacagggctaccgtcttgctg
gtgagcaccgaggatgcgcttctgcagcagctggcggagtcgatgctcaaagatgactgt
gcgtccgagctgagggtccacttggccaactccctccctctgccctccaatgtgaaccgg
ccccgaattgacctgattgtgtttgtgattaacctgcacagcaaatacagtctccagaaa
gtggaggagtttctgcagcacgtggacagcagcttcttcctggggaaagtgtgcttcctt
gtcacaggggcgggacaggaaagccactgcagcgtccaccagaacacagttataaaactg
gcccacacctaccgaagcccgctgctcctctgtgatttacaggtggaaagctttcgtgca
gccatggcgcggcgtctggtgcgcattctgcagatctgcgctggccatgtgccaggcgtc
tccgcgctgaacctgatgtccttgctgcggagccccgagaaccccccatccaaggagctg
tga

DBGET integrated database retrieval system