KEGG   Mus musculus (mouse): 66583Help
Entry
66583             CDS       T01002                                 

Gene name
Exosc1, 2610035C18Rik, 2610104C07Rik, 2610312F07Rik, AI447561
Definition
(RefSeq) exosome component 1
  KO
K07573  exosome complex component CSL4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    66583 (Exosc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    66583 (Exosc1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     66583 (Exosc1)
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Core exosome
     66583 (Exosc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EXOSC1 ECR1_N
Motif
Other DBs
NCBI-GeneID: 66583
NCBI-ProteinID: NP_079920
MGI: 1913833
Ensembl: ENSMUSG00000034321
UniProt: Q9DAA6
Position
19; 19 C3
AA seq 195 aa AA seqDB search
MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKTSENGAVPVVSVMRETE
SQLLPDVGAVVTCKVSSINSRFAKVHILYVGSTPLKNAFRGTIRKEDIRATEKDKVEIYK
SFRPGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHSESGVQMVPISWCEMQCPKTHTK
EFRKVARVQPEFLQT
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaccggtgaggtactgcatccccggcgaacgtctgtgtaacttggaggaaggc
agccccggcagcggcacctacacccggcatggctacatcttttcgtcgctggctggctgc
ctgatgaagaccagcgagaatggcgcggttcccgtggtgtcagtgatgagagaaacagag
tcccagttgcttccagatgtgggagctgtcgtcacctgtaaggtctctagcatcaactca
cggtttgccaaagtacacatcctgtatgtgggatccacaccactcaaaaatgcttttcga
ggaactatccgcaaagaagatatccgagcaactgaaaaagacaaggtagaaatttacaag
agttttcggccaggtgacatagttttggccaaagttatctccctaggcgatgcacagtcc
aattacctgctgactactgctgaaaacgagctgggcgttgtggtggcccacagtgagtca
ggtgttcagatggttcccatcagctggtgtgagatgcagtgccccaagacccacactaaa
gaattccgaaaagtggcccgagtacagcccgagttcctacagacctaa

DBGET integrated database retrieval system